KEGG   Aeromonas veronii: B565_2825Help
Entry
B565_2825         CDS       T01462                                 

Definition
Indole-3-glycerol phosphate synthase/N-(5'phosphoribosyl)anthranilate isomerase
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
avr  Aeromonas veronii
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B565_2825
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B565_2825
Enzymes [BR:avr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     B565_2825
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     B565_2825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3181072..3182580
Genome map
AA seq 502 aa AA seqDB search
MSATTLHNSHSERPQGKSQFRKDNEMSDLIAPHAFLNMASISQTILGKIVAAKQEWVAAR
KLAQPLESFQSALTPSDRDFVGALKAGSTRFILECKKASPSKGLIRNDFSPEAIADIYGK
YATAISVLTDEKFFKGDFAFLPRVRSRVQQPVLCKDFMIDPYQVYLARHYQADAILLMLS
VLTDEGYRALFAVAKELGLGVLTEVSNEEELTRAIALGAPVIGINNRDLRDLSVDLNRTK
QLAKDIPSDRVVISESGINHRAQVADLRHHAKGFLVGSSLMAEPDLEAAVRKLVLGQNKV
CGLTRAEDAAAAHQAGAVFGGLIFVSKSPRYVDIPAARAVMAGAPLSYVGVFRNAQPATI
AKTVDALGLAAVQLHGDEDAAYIDTLRPLLPAGCQIWKAVGVSLGKESGEPLPALDYPAD
RLLLDTKVGSQSGGTGQAFDWALLANLDKAKLMLAGGLNPDNALQAAQVGCLGLDFNSGV
ESAPGQKDAHKIAAAFGALRNL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccaccacattgcacaacagtcattcagaacgcccgcagggcaagagccagttt
cgcaaggataacgagatgtcagaccttatcgccccccatgcttttctgaacatggcctcc
atcagccagaccattctcggcaagatcgtggcggccaagcaggagtgggtcgccgcccgc
aagctggcccagccgctggagagcttccagagcgcgctgacccccagcgatcgggatttc
gtaggcgccctcaaggcgggctccacccgctttattctggagtgcaagaaggcctccccc
tccaaggggttgatccgcaatgatttcagcccggaggccatcgccgacatctatggcaaa
tacgccaccgccatctcggtgctgaccgacgagaagttctttaagggggatttcgccttt
ttgccgcgggtgcgcagccgtgttcagcagccggtgctctgcaaggatttcatgattgac
ccctatcaggtctatctggcccgccactatcaggcggacgccatcctgctgatgctctcg
gtgctcaccgacgaggggtatcgcgccctgttcgcggtggccaaggagctgggcctgggc
gtgctaaccgaggtgagcaatgaggaggagctgacccgcgccatcgcgctgggcgcgccg
gtcattggcatcaacaaccgggatctgcgcgatttgagcgtcgatctgaaccgcaccaaa
cagctggctaaagatattccgagcgatcgggtggtgatcagcgagtccggcatcaaccac
cgcgctcaggtggcggatctgcgccaccacgccaagggctttctggtgggctcgtcattg
atggccgagccggacctggaagcggctgtgcgcaagctggtactgggccagaacaaggtg
tgcggtctcacccgcgccgaggatgctgccgccgcccatcaggcgggtgcggtgtttggc
ggcctgatttttgtttccaaaagcccgcgctatgtagacatccccgccgcccgcgccgtg
atggcgggtgcgccgctctcttacgtcggggtttttcgcaacgcccaacccgccaccatt
gccaagacggtggatgcgctggggctcgccgcagtccagctgcatggggatgaggatgcc
gcctatatcgacaccctgcgtccgctgctgcccgcgggctgccagatctggaaggccgta
ggcgtctctctcggcaaagaaagtggcgaaccgctgcccgccctcgactacccggccgat
cgcctgctgctggataccaaagtaggcagccagagcggcggcaccggtcaggcgttcgac
tgggccctgttggcaaatctcgataaagccaagttgatgctggcggggggcctcaatccc
gacaacgccctgcaagcggcacaagtgggctgcctcggccttgatttcaactccggggtg
gagagtgccccgggccagaaggatgcgcacaagattgcagccgccttcggcgcactgcgc
aacctgtaa

DBGET integrated database retrieval system