KEGG   Aeromonas veronii B565: B565_2825Help
Entry
B565_2825         CDS       T01462                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase/N-(5'phosphoribosyl)anthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
avr  Aeromonas veronii B565
Pathway
avr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
avr01100  Metabolic pathways
avr01110  Biosynthesis of secondary metabolites
avr01130  Biosynthesis of antibiotics
avr01230  Biosynthesis of amino acids
Module
avr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B565_2825
Enzymes [BR:avr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     B565_2825
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     B565_2825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AEB50860
Position
3181072..3182580
Genome map
AA seq 502 aa AA seqDB search
MSATTLHNSHSERPQGKSQFRKDNEMSDLIAPHAFLNMASISQTILGKIVAAKQEWVAAR
KLAQPLESFQSALTPSDRDFVGALKAGSTRFILECKKASPSKGLIRNDFSPEAIADIYGK
YATAISVLTDEKFFKGDFAFLPRVRSRVQQPVLCKDFMIDPYQVYLARHYQADAILLMLS
VLTDEGYRALFAVAKELGLGVLTEVSNEEELTRAIALGAPVIGINNRDLRDLSVDLNRTK
QLAKDIPSDRVVISESGINHRAQVADLRHHAKGFLVGSSLMAEPDLEAAVRKLVLGQNKV
CGLTRAEDAAAAHQAGAVFGGLIFVSKSPRYVDIPAARAVMAGAPLSYVGVFRNAQPATI
AKTVDALGLAAVQLHGDEDAAYIDTLRPLLPAGCQIWKAVGVSLGKESGEPLPALDYPAD
RLLLDTKVGSQSGGTGQAFDWALLANLDKAKLMLAGGLNPDNALQAAQVGCLGLDFNSGV
ESAPGQKDAHKIAAAFGALRNL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccaccacattgcacaacagtcattcagaacgcccgcagggcaagagccagttt
cgcaaggataacgagatgtcagaccttatcgccccccatgcttttctgaacatggcctcc
atcagccagaccattctcggcaagatcgtggcggccaagcaggagtgggtcgccgcccgc
aagctggcccagccgctggagagcttccagagcgcgctgacccccagcgatcgggatttc
gtaggcgccctcaaggcgggctccacccgctttattctggagtgcaagaaggcctccccc
tccaaggggttgatccgcaatgatttcagcccggaggccatcgccgacatctatggcaaa
tacgccaccgccatctcggtgctgaccgacgagaagttctttaagggggatttcgccttt
ttgccgcgggtgcgcagccgtgttcagcagccggtgctctgcaaggatttcatgattgac
ccctatcaggtctatctggcccgccactatcaggcggacgccatcctgctgatgctctcg
gtgctcaccgacgaggggtatcgcgccctgttcgcggtggccaaggagctgggcctgggc
gtgctaaccgaggtgagcaatgaggaggagctgacccgcgccatcgcgctgggcgcgccg
gtcattggcatcaacaaccgggatctgcgcgatttgagcgtcgatctgaaccgcaccaaa
cagctggctaaagatattccgagcgatcgggtggtgatcagcgagtccggcatcaaccac
cgcgctcaggtggcggatctgcgccaccacgccaagggctttctggtgggctcgtcattg
atggccgagccggacctggaagcggctgtgcgcaagctggtactgggccagaacaaggtg
tgcggtctcacccgcgccgaggatgctgccgccgcccatcaggcgggtgcggtgtttggc
ggcctgatttttgtttccaaaagcccgcgctatgtagacatccccgccgcccgcgccgtg
atggcgggtgcgccgctctcttacgtcggggtttttcgcaacgcccaacccgccaccatt
gccaagacggtggatgcgctggggctcgccgcagtccagctgcatggggatgaggatgcc
gcctatatcgacaccctgcgtccgctgctgcccgcgggctgccagatctggaaggccgta
ggcgtctctctcggcaaagaaagtggcgaaccgctgcccgccctcgactacccggccgat
cgcctgctgctggataccaaagtaggcagccagagcggcggcaccggtcaggcgttcgac
tgggccctgttggcaaatctcgataaagccaagttgatgctggcggggggcctcaatccc
gacaacgccctgcaagcggcacaagtgggctgcctcggccttgatttcaactccggggtg
gagagtgccccgggccagaaggatgcgcacaagattgcagccgccttcggcgcactgcgc
aacctgtaa

DBGET integrated database retrieval system