KEGG   Aeromonas veronii: B565_2826Help
Entry
B565_2826         CDS       T01462                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
avr  Aeromonas veronii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B565_2826
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B565_2826
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B565_2826
Enzymes [BR:avr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     B565_2826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
3182628..3183821
Genome map
AA seq 397 aa AA seqDB search
MTLLNPFFGEFGGMYVPQILIPALLQLEKAFVDAKDDPAFIAEFQSLLTEYAGRPTPLTL
TRNLTKGTKTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDCERQKPNVFRMKLMGATVIPVHSGSSTLKDACNEALRDWAANY
ESAHYLLGTAAGPHPFPTIVREFQKMIGEEAKAQCFEKEERLPDAVIACVGGGSNAIGMF
ADFIDEPSVRLIGVEPGGHGIESGEHGAPLGHGSKGVFFGMHSYLMQDNQGQIQESYSVS
AGLDFPSVGPQHAHLAAIGRAEYPSVTDKEALDAFQELAKSEGIIPALESSHALAHALKM
ARSEPEKEQVLIVNLSGRGDKDIFTVADIFEKEGTLS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgctcaacccgtttttcggcgaatttggtggcatgtatgtgccccaaatcctt
atcccggccctgctccagctggaaaaagcctttgtcgatgccaaggatgatccggccttt
atcgccgagtttcagtccctgctgaccgagtatgccggtcgcccgaccccgctcaccctg
acccgcaatctgaccaagggcaccaagacccgcctctatctgaagcgtgaagatctgctg
cacggcggcgcccacaagaccaaccaggtgctgggtcaggcgctgctggccaagcggatg
ggcaagaacgagatcatcgccgagaccggcgccggtcagcatggcgtcgccactgcgctg
gcctgcgccctgctcggcctcaagtgccgggtctatatgggtgccaaggattgcgagcgc
cagaagcccaacgtatttcgcatgaagttgatgggcgccaccgtcattccggtgcactcc
ggctcgtccaccctgaaagatgcctgtaacgaggcgctgcgcgactgggccgccaactac
gagtcggcccactacctgctcggcaccgccgcgggtccgcaccccttccccactatcgtg
cgggagttccagaagatgatcggcgaagaggccaaagcccagtgcttcgagaaggaggag
cgactgcccgatgcggtgatcgcctgcgtcggcggcgggtcgaacgccatcggcatgttt
gccgactttatcgatgagccgtcggtgcgtctgatcggcgtcgagccgggcggtcacggt
atcgagagtggcgagcacggtgcgccgctcggtcacggcagcaagggagtcttctttggc
atgcactcctacctgatgcaggacaatcaggggcaaattcaggagtcctactccgtttcg
gcagggctggatttcccctccgtcggcccgcagcacgcccatctggccgccatcggccgc
gccgagtacccctcggtgaccgacaaggaggcgctggacgccttccaggagctggccaaa
tccgaaggcatcatacccgcgctggagtcctcccacgcgctggcccacgccctcaagatg
gcccgcagtgaaccagaaaaagagcaggtgctcatcgtcaacctctccggccgtggcgac
aaagatatcttcaccgtcgctgacattttcgagaaagaaggaaccttgtcatga

DBGET integrated database retrieval system