KEGG   Aeromonas veronii: B565_3183Help
Entry
B565_3183         CDS       T01462                                 

Definition
chemotaxis response regulator
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
avr  Aeromonas veronii
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:avr02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:avr02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3591828..3592886
Genome map
AA seq 352 aa AA seqDB search
MKQIRVMLVDDSAVVRQVLQAVLEQEPDIRVIATASDPLFAQEKLKKEWPDVIVLDVEMP
RMDGITFLTKIMAEHPTPVVICSSLTEKGAETTLQAMAAGAVDIITKPTMGIKSFLQESA
HDLAMAVRAAAQANLKRVGKPSSVPVSTKLNADAMLPPNQHAMAQTTERLIAIGTSTGGT
QALEAVLTALPRVSPGIVIVQHMPEKFTAMFAERLNGVCQIEVREARNNDRVIPGLALIA
PGGKHMLLKRSGAYYHVEVVDGPLINRHRPSVDVLFRSVAKYAGKNATGIIMTGMGDDGA
RGLREMLDAGANTYAQDEASCVVFGMPKEAIKLGAARHVLPLQEMQYAILGK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagatccgggtcatgctggtggatgattccgccgtggtcagacaggtattgcaa
gcggtgctggagcaggagcccgatatccgggtgatcgccacagcatcggatcccctgttt
gcccaggaaaaactgaagaaagagtggcctgacgtcatcgtgctcgatgtggagatgccc
cgtatggatggcatcacctttctcaccaagatcatggcagagcatccaaccccggtggtg
atctgctcctccctcaccgaaaagggggccgagacaaccttgcaggcaatggctgccggc
gcggtggacatcatcaccaagccgaccatggggataaaaagctttctgcaagaatctgcc
cacgacctggctatggcagtacgtgctgcggctcaggccaacctcaagcgcgtgggcaag
ccctcctctgtgccggtcagcaccaaactcaacgcagatgccatgctgccgcccaaccag
cacgccatggcacaaaccaccgagcggctcatcgccatcggcacctcgaccggcggtacc
caggcgctggaagccgtgctgacagccttgccccgggtcagccccggcattgtcatcgtg
cagcacatgccagagaaatttaccgccatgtttgcagaacgcctgaacggggtctgccag
attgaagtgcgggaggcgaggaacaatgaccgggtgatcccggggctggcgctgattgcc
cccggaggcaagcatatgctgctcaaacgcagcggtgcctactatcacgtcgaggtggtc
gacgggccgcttatcaaccgccatcgcccctcggtggatgtgctgtttcgctccgtcgcc
aaatatgccggcaagaatgccaccggcatcatcatgaccggcatgggggatgacggagcc
cggggattgcgcgagatgctggatgcgggtgccaacacctatgcccaggatgaggcctcc
tgcgtggtcttcggcatgcccaaggaggcgatcaagctgggagcagcccgccatgtgctc
cccttgcaagagatgcagtacgccatcctcggcaagtaa

DBGET integrated database retrieval system