KEGG   Aeromonas veronii: B565_3192Help
Entry
B565_3192         CDS       T01462                                 

Definition
Triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
avr  Aeromonas veronii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B565_3192
   01230 Biosynthesis of amino acids
    B565_3192
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B565_3192
   00051 Fructose and mannose metabolism
    B565_3192
   00562 Inositol phosphate metabolism
    B565_3192
Enzymes [BR:avr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     B565_3192
Exosome [BR:avr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   B565_3192
  Exosomal proteins of bladder cancer cells
   B565_3192
  Exosomal proteins of melanoma cells
   B565_3192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3602603..3602941)
Genome map
AA seq 112 aa AA seqDB search
MIAEELDIVIEKNGAMAFDNAIIAYEPIWAVGTGKCATPEQAQEVHSFIRGRLAEDTPVI
GEKVRIIYGGSVTPSNARDLFAQPDIDGGLIGGASLDSDAFLGIVEAAKGAS
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgctgaagagctggatatcgtcatagagaaaaatggcgcgatggctttcgataat
gctatcatcgcctacgagccgatttgggctgtaggtacaggtaaatgcgccacacccgag
caggcacaagaggttcattcctttatacgtggtcgcttggcggaggatactccggtaata
ggtgagaaagttagaatcatctatggtgggagcgtaacgccgagcaacgcgagagatttg
tttgcacagcccgacattgatggcggactgattggcggagcaagcctcgatagcgatgcg
tttttaggaattgttgaagcggcaaagggtgcaagttaa

DBGET integrated database retrieval system