KEGG   Aeromonas veronii B565: B565_3192Help
Entry
B565_3192         CDS       T01462                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
avr  Aeromonas veronii B565
Pathway
avr00010  Glycolysis / Gluconeogenesis
avr00051  Fructose and mannose metabolism
avr00562  Inositol phosphate metabolism
avr01100  Metabolic pathways
avr01110  Biosynthesis of secondary metabolites
avr01120  Microbial metabolism in diverse environments
avr01130  Biosynthesis of antibiotics
avr01200  Carbon metabolism
avr01230  Biosynthesis of amino acids
Module
avr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
avr_M00002  Glycolysis, core module involving three-carbon compounds
avr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B565_3192
   00051 Fructose and mannose metabolism
    B565_3192
   00562 Inositol phosphate metabolism
    B565_3192
Enzymes [BR:avr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     B565_3192
Exosome [BR:avr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   B565_3192
  Exosomal proteins of bladder cancer cells
   B565_3192
  Exosomal proteins of melanoma cells
   B565_3192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEB51227
Position
complement(3602603..3602941)
Genome map
AA seq 112 aa AA seqDB search
MIAEELDIVIEKNGAMAFDNAIIAYEPIWAVGTGKCATPEQAQEVHSFIRGRLAEDTPVI
GEKVRIIYGGSVTPSNARDLFAQPDIDGGLIGGASLDSDAFLGIVEAAKGAS
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgctgaagagctggatatcgtcatagagaaaaatggcgcgatggctttcgataat
gctatcatcgcctacgagccgatttgggctgtaggtacaggtaaatgcgccacacccgag
caggcacaagaggttcattcctttatacgtggtcgcttggcggaggatactccggtaata
ggtgagaaagttagaatcatctatggtgggagcgtaacgccgagcaacgcgagagatttg
tttgcacagcccgacattgatggcggactgattggcggagcaagcctcgatagcgatgcg
tttttaggaattgttgaagcggcaaagggtgcaagttaa

DBGET integrated database retrieval system