KEGG   Aeromonas veronii: B565_3288Help
Entry
B565_3288         CDS       T01462                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
avr  Aeromonas veronii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B565_3288
  Amino acid metabolism
   00330 Arginine and proline metabolism
    B565_3288
Enzymes [BR:avr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     B565_3288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3706271..3707296)
Genome map
AA seq 341 aa AA seqDB search
MVELVRQCAALHRHGHRVVVVTSGAIAAGREHLGHPPLAPTLPNKQMLAAVGQTQLIRVW
QDLFNLYGLHIGQMLLTRADLEDRERYLNARDTMRTLLDHRIIPVINENDAVATAEIKVG
DNDNLSARAAILADADLLILLTDQKGLFTADPRTNPDAQLIEEVQTIDDTLRSLAGDSVS
GLGTGGMATKLQAADVARRAGVNVVIATGQMPEVIGRLAKGERIGTLFPALASPLEGRKS
WILAGPPPHGEVHVDQGAVAAMKDKGSSLLPKGIVAVRGDFIRGDVVRILDPKGAELARG
ICRYDHLELEKLRGVHSDQIEQVLGYGYGSVAIHRDDMVLL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggtcgagctggtcagacagtgtgcggccttgcaccgtcacggccatcgtgtcgtggtc
gtcacatcaggggctatcgccgccgggcgtgaacatctgggccacccgccactggcgcca
accctgcccaacaagcagatgctggcggcggttggtcagacccagcttattcgggtatgg
caagatctgttcaacctctacggtctgcatatcggccagatgctgctgacccgcgccgat
ctggaagatcgggagcgctacctcaacgcccgcgacaccatgcgcaccctgctcgatcac
cgcattattccggtcatcaacgaaaacgatgcggtggcgaccgccgagatcaaggtcggc
gacaacgacaacctctccgcacgggccgccattctggcggatgcggatctgctgatcctg
ctgaccgaccagaaggggctctttaccgccgatccgcgcaccaatcccgatgcccagctt
attgaagaggtgcagactattgacgataccctgcgctcgctggcgggtgacagtgtcagt
ggcctcggcaccggcggcatggctaccaagctgcaggccgctgatgtggcacgtcgcgct
ggcgtcaatgtggtgatcgcgaccggccagatgccggaggtgatcggccgtctcgccaag
ggtgagcgtatcggtaccctcttcccagcgctggcctccccgctggaagggcgcaagagc
tggatcctggcaggcccgccccctcacggcgaagtgcatgtggatcagggggctgtcgcc
gccatgaaggataaaggctccagcctgctgcccaaggggatcgtcgcggtcaggggcgat
tttattcggggcgatgtggtgcgcattcttgatcccaaaggcgccgaactggcccgcggc
atctgccgttacgaccatctggagctggagaagttgcgcggcgtccactcggatcagatt
gagcaggtactgggctatggatatggttcagtagccatccatcgagacgatatggtgctg
ctctaa

DBGET integrated database retrieval system