KEGG   Aeromonas veronii B565: B565_3321Help
Entry
B565_3321         CDS       T01462                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
avr  Aeromonas veronii B565
Pathway
avr00010  Glycolysis / Gluconeogenesis
avr00520  Amino sugar and nucleotide sugar metabolism
avr01100  Metabolic pathways
avr01110  Biosynthesis of secondary metabolites
avr01120  Microbial metabolism in diverse environments
avr01130  Biosynthesis of antibiotics
avr01200  Carbon metabolism
Module
avr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
avr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B565_3321
   00520 Amino sugar and nucleotide sugar metabolism
    B565_3321
Enzymes [BR:avr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     B565_3321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: AEB51356
Position
3740986..3741726
Genome map
AA seq 246 aa AA seqDB search
MHMLGVDIGGSGIKGCLVDTKTGELIGERHRIATPQPATPAAIAHTLKALVEHFDWKGPV
GCGFPATIHNGIAKSAANIDKSWIETDAEHLFADVTGKPCYVLNDADAAGLAEMRFGAGK
DRKGVIILITVGTGIGTAIFVNGHLLPNTELGHLMLEGMVAEHYCSDAARKREDLSWNRW
GKRFNKYLARLEFLFSPDLFILGGGSAAKLDKFVDRIETRAPLIPAASLNQAGIIGAALY
AAEQQG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcatatgttgggagtggatattggaggctctgggatcaagggctgtctggtggatacc
aaaaccggcgaactgatcggcgagcgccatcgcattgccacgccgcaaccggccaccccg
gccgccatcgcccataccctcaaggcgttggtcgaacactttgactggaaagggccggtg
ggctgcggctttcccgccaccattcacaacggcattgccaagagtgccgccaatatcgac
aagagctggattgagaccgatgccgagcatctgtttgccgatgttaccggcaagccctgc
tatgtgctgaatgatgccgatgccgccggtctggccgagatgcgctttggcgctggcaag
gatcgcaagggggtcatcatcctcatcacggtcggcaccggtatcggcaccgccatcttc
gtcaatggccatctgctgcccaacaccgagctgggccatctgatgctggaaggaatggtc
gccgagcactactgctccgatgcggcgcgcaaacgggaagatctctcctggaaccgctgg
ggcaagcgtttcaacaagtatctggcgcgcctcgagtttctcttctcccccgacctcttc
attctggggggcggcagcgcagccaagctggataagtttgtcgatcgcatcgagacccgg
gcgccgcttattccggcggccagcctcaatcaggcgggcattatcggggccgcgctctac
gcggccgagcagcagggctaa

DBGET integrated database retrieval system