KEGG   Aeromonas veronii: B565_3350Help
Entry
B565_3350         CDS       T01462                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
avr  Aeromonas veronii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B565_3350
   00052 Galactose metabolism
    B565_3350
   00500 Starch and sucrose metabolism
    B565_3350
   00520 Amino sugar and nucleotide sugar metabolism
    B565_3350
Enzymes [BR:avr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     B565_3350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3773112..3774023
Genome map
AA seq 303 aa AA seqDB search
MKKTPLTVRKAVLPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVREAIAAGIKEIVLV
THSSKNSIENHFDKSFELEATLEKRVKRQLLEEVQQICPKDVTIMHVRQGEAKGLGHAVL
CARPLIGDNPFAVLLPDVLIDEVASDPKKDNLAEMVHMFEENQISQIMVEAVPESEVDKY
GIADIKGEALREGMSLPMQAIVEKPPRDEAPSNLAVVGRYVLSSNIWPLLEKTPAGAGDE
IQLTDAIAMLMEQEQVNAYFMKGKSHDCGSKLGYMKANVEYGVRHHELNGEFIGWLKQFV
KQL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagacccctctgacagttcgcaaggccgtgctcccggtagccggtctgggtacc
cgtatgctgccagccaccaaggccatcccgaaagagatgctgccggtggtcgacaaaccg
ctgatccagtacgtagtgcgcgaagccatcgccgccgggatcaaggagatcgtgctggta
acccactcgagcaagaactccatcgaaaaccacttcgacaagagtttcgaactggaagcg
accctcgagaagcgggtcaagcgtcaactgctggaagaggtgcaacagatctgcccgaaa
gacgtcactatcatgcacgtccgtcagggtgaggccaaaggtctgggccacgctgtgttg
tgcgcccgcccgctgatcggtgacaaccccttcgccgtgctgctgccggatgtactgatt
gatgaagtggccagcgacccgaaaaaagacaacctggccgagatggtacacatgttcgaa
gagaaccagatcagccagatcatggtggaagcggttcccgagagcgaagtggacaagtac
ggcatcgccgacatcaagggcgaggccctgcgcgaggggatgtccctgccgatgcaggcc
attgtcgagaagccgccccgtgacgaagccccctccaatctggcggtggtgggtcgttac
gtcctctcctccaatatctggccgctgctggagaaaaccccggccggtgccggtgacgag
atccagctgacggacgccatcgccatgctgatggagcaggaacaagtcaacgcctacttc
atgaagggcaagagccacgattgcggtagcaagctcggttatatgaaagccaatgtggaa
tatggtgttcgccatcacgagctgaatggtgaattcatcggctggctgaagcagttcgtc
aagcagttgtaa

DBGET integrated database retrieval system