KEGG   Aeromonas veronii: B565_3423Help
Entry
B565_3423         CDS       T01462                                 

Definition
hypothetical protein
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
avr  Aeromonas veronii
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    B565_3423
   00240 Pyrimidine metabolism
    B565_3423
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    B565_3423
   03430 Mismatch repair
    B565_3423
   03440 Homologous recombination
    B565_3423
Enzymes [BR:avr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     B565_3423
DNA replication proteins [BR:avr03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     B565_3423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3860081..3860515
Genome map
AA seq 144 aa AA seqDB search
MQDPVRQSMLARMGIQSWQLRRPALLGAAPAPELAQDAVQPDQTAPATSAPLPSGKLWLL
APQLPATTLLADICQLLGMTPDEVSLLSELPPADLQTAGASPLLWLTEANPARPNALICP
LTPSAAQKRALWQQLRQHLAASAA
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatcccgttcgtcagagcatgttggcccgcatgggcattcaaagctggcaactg
cgtcgtccggcattgctgggcgcagctcccgctcccgagcttgcgcaagatgccgtgcag
cccgaccagacagcaccggccaccagcgctccgctacccagcggcaaactctggctgctg
gcgcctcagctgcctgccaccacgctgctggcggatatctgccagttgctcggcatgacc
cccgacgaggtctcactgctcagcgagctgccgcctgccgatctgcaaacggcgggcgcc
tcccctctgctctggctgacggaggccaaccccgcgcggccaaatgcgctgatctgcccg
ctcacccccagcgccgcgcaaaagcgcgccctgtggcaacagctgcgccaacaccttgcg
gccagcgcagcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system