KEGG   Aeromonas veronii: B565_3452Help
Entry
B565_3452         CDS       T01462                                 

Definition
Thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
avr  Aeromonas veronii
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    B565_3452
Enzymes [BR:avr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     B565_3452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3887358..3888689)
Genome map
AA seq 443 aa AA seqDB search
MFLPQEIIRKKRNGEALSTQEIQFFVQGITNNTIGEGQIAALAMAVYFKDMTMDERVALT
CAMRDSGMVLTWDHLNLGGPIVDKHSTGGVGDVVSLMLGPMVAACGGFVPMISGRGLGHT
GGTLDKLDAIPGYQTSVDNDRFLKVVKEAGVAIIGQTGDLAPADKRIYAVRDITATVESI
AMITGSILSKKLASGLEALVMDVKVGSGAFMPTFEASEELAKSIVAVANGAGCRTSALLT
DMNQVLASSAGNAVEVREAVRYLTGEYRNPRIHEVTMALCAEMLISAGLASDERDARTKL
QAVLDNGKAAEIFGRMVTGLGGPADFMERYDVYLPKAAIVRPVFAANSGFVTAMDTRELG
LAVVAMGGGRRAAGDKLDYAVGLTDFIRLGQSVDADKPIAMIHAQTEEQYAQAASMVQAA
VRIGGERPEALPEVYRRITLADL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgcctcaagaaattattcgcaagaagcgcaacggtgaagcgctcagtacccaa
gaaattcaattcttcgttcagggcattaccaataacaccatcggtgaggggcagattgcg
gcgctggcgatggcggtctacttcaaagacatgaccatggatgagcgggttgccctgacc
tgcgccatgcgcgactccggcatggtgctgacctgggatcacctcaatctgggtggcccg
attgtcgacaagcactccaccggcggggtgggtgatgtcgtctccctgatgcttggcccg
atggtcgctgcctgcggcggtttcgtgccgatgatctccggccgtggtctgggccacacc
ggcggtaccctcgacaagctggacgccattcccggctaccaaacctcggtcgacaacgac
cgtttcctgaaagtggtgaaagaggcgggtgtcgccatcatcggccagaccggcgatctt
gcccccgctgacaagcgtatctatgcagtacgtgacattaccgccaccgttgaatccatc
gccatgatcaccggctccatcctctccaagaagctcgcctccgggctggaagcgctggtg
atggatgtgaaagtgggctccggcgcctttatgccgaccttcgaagcgtccgaagagctg
gccaagagcattgtggccgtggccaacggtgccggttgccgcacctctgcgctcttgacc
gatatgaaccaggtgctggcctccagtgccggtaacgcggtggaagtgcgtgaagcggtg
cgttacctgaccggtgaataccgcaacccgcggatccacgaagtgaccatggcgctgtgc
gccgagatgctgatctccgccggtcttgccagcgacgagcgcgatgcccgcaccaagctg
caggcggtgctggataacggcaaggcggccgagatcttcggtcgcatggtgacaggtctc
ggtggcccggccgattttatggagcgttatgacgtttacctgcccaaggccgccatcgtg
cgcccggtcttcgcggccaacagcggcttcgtgaccgccatggatacccgcgagctgggt
ctggccgtggtcgccatgggcggtggtcgccgcgctgccggtgacaaacttgattatgcg
gtcggtctgaccgactttatccgcctgggtcaaagcgtcgatgctgacaagccgatcgcg
atgatccacgctcagactgaagagcaatatgctcaggctgccagcatggtgcaggcggct
gtccggattggtggcgagcggccggaggcactgcctgaagtgtaccgccgtatcaccctg
gccgatttgtaa

DBGET integrated database retrieval system