KEGG   Aeromonas veronii: B565_3760Help
Entry
B565_3760         CDS       T01462                                 

Definition
Pteridine reductase 1
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
avr  Aeromonas veronii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:avr00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:avr00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4230376..4231080)
Genome map
AA seq 234 aa AA seqDB search
MRALVTGCGRRLGFYLCEQLVTAGWQVTGSYRSERPELATLAALGVELVLADFGREEDVG
KLIDVLETHQDLTLVIHNASAFEPQATEPAAQLAQFEQFYRVHMAAPFQLNRALAPQLAS
NPNASIIHITDIYIHAPAPRFASYVATKAGAHSLAMSFARELAPAVRVNTIEPGPILFLD
EHDEAWRQQVLAKTPLAREGGLEPIWQAVQLLMGNSYMTGASIKVDGGRALATL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcattggttacaggctgcggccgtcgactcggattttatctctgtgaacagctg
gtgacggcgggttggcaggtgacgggcagttatcgcagcgagcggccggagctggccacg
ctggcggcactgggggtcgagctggtgctggcggattttggtcgggaagaggacgttggc
aagctgatcgatgtgctggagacccatcaggatctgacgctggtgatccacaacgcctcg
gccttcgagccgcaggcaactgagccggcggcgcaactggcccagttcgagcagttctac
cgggtgcacatggcggcccccttccagctaaaccgggcgctggccccccagctggccagc
aatcccaacgccagcatcattcacatcaccgatatctatattcatgccccggccccccgt
tttgccagctatgtggccaccaaggcgggagcccattcgctagccatgagctttgcccgg
gagctggcgcctgcggttcgggtcaacaccatagagccggggccgatcctgtttctcgac
gagcatgacgaggcatggcgccagcaggtgttggcgaaaacaccgctggcgcgggagggg
ggacttgagcccatctggcaggcggtgcagttactgatggggaacagttatatgacgggg
gccagcatcaaggtagatggcgggcgggcgctggccactctctga

DBGET integrated database retrieval system