KEGG   Aeromonas veronii: B565_3846Help
Entry
B565_3846         CDS       T01462                                 

Definition
Pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
avr  Aeromonas veronii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    B565_3846
Enzymes [BR:avr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     B565_3846
    3.5.1.-  
     B565_3846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4324792..4325427
Genome map
AA seq 211 aa AA seqDB search
MGTVASLDIDAQKGFTPLCPNELPVAGGDDIVAALNAQATLATLRIGSKDSHPANADWAV
SDPAGMLLPLDLPNADLTWPVHCVPGSKGFELLDGLPAPIDYDFFVWKGVEPDLHPYGTC
FHDLAERRSTGLIEFLQARQVDTVLVGGLATDYCVKTSVLQLRRAGFRVIVHLDACRGIA
PATVASAHTQMIEAGAELAQTLIDVQRLLDA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccgtcgccagcctggatattgatgcgcagaagggctttacccccctctgcccg
aacgaactgcccgtcgcgggcggtgatgatattgtggctgcgctaaacgctcaggccacc
ctcgccacgctgcggatcggcagcaaggactctcaccctgccaatgccgactgggccgtt
tctgaccccgcaggtatgctgctgccgctggatctgcccaacgccgacctcacctggccg
gttcactgcgtaccgggcagcaagggcttcgagctgctcgacggcctgcccgcccccatc
gactatgacttcttcgtctggaagggggtcgagcctgatctgcatccctacggcacctgc
ttccacgacctggctgaacggcgcagcaccggactcatcgaattcctgcaagcccgccag
gtcgataccgtactggtcggcggcctcgccaccgactactgtgtcaaaaccagcgtgctg
caactgcgccgcgccggtttccgggtgatcgtccatctcgatgcctgccgtggcatcgcc
cccgcgacggttgccagcgcccacacccagatgatcgaggcaggggccgaactggcccag
accctgatcgatgtacaacgcctgctggacgcctga

DBGET integrated database retrieval system