KEGG   Acetobacterium woodii: Awo_c00640Help
Entry
Awo_c00640        CDS       T01732                                 

Definition
xaa-His dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
awo  Acetobacterium woodii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:awo01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:awo00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
66681..67946
Genome map
AA seq 421 aa AA seqDB search
MNYNLNEKKLLSDLKGLLQIDSTNADAGAIIPEAPLGTGINNAINYVLALGKSFGFKTKN
CDGYCGYIEMGQGEEMIGILTHVDTVPVGTGWSVNPFDLTIDGDKAYGRGTIDDKGPTMV
ALYAMKALAESGVPINKRVRLIIGGDEEGEEWHCMNHYKLTEEPPTYAFSPDSGYPAIFA
EKGILNVCIKKKLEPTIPELGFFSGSQINTVPDYAKAIVRDTVYESIGKPAHASQPQEGI
NAMFLLTQKLRTLGVEHPFLDLVEIASSEGLNIDVEDEISGKLTINPSIANVNQDKAVLK
CDIRYPVTMNGADIRNRIAQAVRPLGFDVNINYDMAPLHLDKESYLIEVLQKIYEDYTGD
KSGPKVIGGGTYARAFDNAVAFGGRFPEEPNTCHQTDEYWSIKSMRKNFDIIAKALESLV
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaattataatctgaacgaaaaaaaactgctaagtgatttgaagggactgctacaaatt
gattcaaccaatgccgatgccggagcgattatcccggaagcacccttaggtacagggatc
aacaatgccattaactatgttctggcactcgggaaaagttttggttttaaaacaaaaaat
tgcgatggttattgtggttatattgaaatgggacaaggtgaagaaatgattggtatcctt
acccatgtggatacagttccggtgggaacgggctggtcggttaacccttttgatctgacg
attgacggagacaaagcttatggtcggggaacaatcgacgataaagggccaaccatggtc
gccctttatgcgatgaaagcgctggctgaaagcggtgttccgataaataaacgggttcgg
ctgattatcggtggagatgaagaaggcgaagagtggcattgcatgaatcactataagttg
acggaagaaccgccaacctatgctttttcacccgattccggatatccggccatttttgcc
gaaaagggaatcttgaatgtctgtatcaaaaaaaagctggagccgacgattccggaattg
ggcttttttagtggcagccagattaatacggttcccgattatgccaaggctattgtccgt
gataccgtttatgagagtatcgggaagccggcccatgcttcacaaccgcaggaagggatt
aatgcgatgtttctgttaacgcagaagttaagaacgttgggggtggaacatccttttctg
gatctcgttgagattgcatcatcagaaggtttgaatattgatgttgaagatgaaatatcg
ggaaaattgaccataaacccatcaattgctaatgtcaatcaggataaagcggtgttaaaa
tgtgatatccgatatcccgttacgatgaacggagccgatatccgtaatcgtattgctcaa
gcggtgcgtccgctgggatttgacgttaacattaattatgatatggcgccattacatctt
gataaagaaagttatctgattgaggtgctgcaaaaaatatacgaagattacaccggggat
aaaagcgggcctaaagttattggcggcgggacctatgcccgggcctttgataatgccgtg
gcttttggggggcgtttcccggaggaaccgaacacctgtcatcagaccgacgaatactgg
agtattaaaagtatgaggaaaaattttgatattatcgcgaaagcattggaaagtttggta
caatga

DBGET integrated database retrieval system