KEGG   Acetobacterium woodii: Awo_c02260Help
Entry
Awo_c02260        CDS       T01732                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase GalU
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
awo  Acetobacterium woodii
Pathway
awo00040  Pentose and glucuronate interconversions
awo00052  Galactose metabolism
awo00500  Starch and sucrose metabolism
awo00520  Amino sugar and nucleotide sugar metabolism
awo01100  Metabolic pathways
awo01130  Biosynthesis of antibiotics
Module
awo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:awo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Awo_c02260 (galU)
   00052 Galactose metabolism
    Awo_c02260 (galU)
   00500 Starch and sucrose metabolism
    Awo_c02260 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Awo_c02260 (galU)
Enzymes [BR:awo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Awo_c02260 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: AFA47035
UniProt: H6LG99
Position
257304..258173
Genome map
AA seq 289 aa AA seqDB search
MKKVRKAVIPAAGLGTRFLPITKSVPKEMLPIVDKPTIQYIIEEIVASGIEEILIINGRN
KDSMINHFDQVPELEALLQAGGKTAALAEVRAITEMAKIFSVRQKEAKGLGHAVLCAKEF
VGDEPFAVVLGDDIVYNNETPALKQMVEVYENYGASVIGVQQVAADQVNKYGIVSGVAVS
ERVYQVDDLVEKPAVGTAPSTMAILGRYIITPGIFDVLEQTGKGAGGEIQLTDGLKTLAT
MEKMYAYDFIGKRYDVGDKLGFLQATVEYGLRNENLGADFKKYLESLLK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtacgcaaagcagttattccggcagcaggattggggacacggtttttacct
attactaaatcggttcccaaggaaatgctgccaatcgttgataaaccgacaatccaatat
attatcgaagaaattgtcgcatcgggaattgaagaaatcctgattattaatggacgcaat
aaagatagtatgattaatcattttgaccaagtaccggaacttgaagcattgttacaagcg
ggtggaaaaacagcggctttagctgaggtgagagcgattaccgagatggcaaaaattttc
tcagtgcggcaaaaagaagcgaaaggtttagggcacgcagttctttgtgcaaaggaattt
gtcggcgatgaaccttttgcagtggttctgggtgatgatattgtttataacaatgaaacg
ccggcacttaaacaaatggtagaagtttatgaaaattatggtgcttcagtgattggggtt
cagcaagtagcggctgatcaggttaataagtatggaatcgtttcaggagtggccgtcagt
gagcgggtttaccaggttgatgatctggtcgaaaaaccggccgtgggaaccgcaccgtca
acaatggctattttaggacgttatatcataaccccgggaatttttgatgtgctcgaacaa
accggaaaaggtgccggtggcgaaatacagcttaccgatggattgaaaacgctggcaaca
atggaaaagatgtatgcttatgattttattggcaaacgttatgatgtgggggataaactg
ggttttttacaggcaactgttgaatatggtttaagaaatgaaaatttgggggcagacttt
aaaaaatatctggaaagtttgttgaaataa

DBGET integrated database retrieval system