KEGG   Acetobacterium woodii: Awo_c02310Help
Entry
Awo_c02310        CDS       T01732                                 

Gene name
rfbC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase RfbC
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
awo  Acetobacterium woodii
Pathway
awo00521  Streptomycin biosynthesis
awo00523  Polyketide sugar unit biosynthesis
awo01130  Biosynthesis of antibiotics
Module
awo_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:awo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Awo_c02310 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Awo_c02310 (rfbC)
Enzymes [BR:awo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Awo_c02310 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AFA47040
UniProt: H6LGA4
Position
263839..264405
Genome map
AA seq 188 aa AA seqDB search
MAKIKVIKTKIDGLVIIEPSVFGDHRGYFMETYNEEEFHQAGLTMRFVQDNESKSSKGVL
RGLHFQTKFSQGKLVRATKGEVYDVAVDLRNGSPTYGQWAGVLLTEENKTMFYIPEGFAH
GFMVVSEEAVFNYKCTNLYAPEYDGGIRWNDPEVGIEWPLDKIDDVLLSEKDEKLPFLNE
ISDSLRFE
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaattaaggtaataaaaacaaaaattgacggattggtgattattgaaccatct
gtttttggtgaccatcgtggttactttatggaaacctataatgaagaagaatttcaccaa
gccggtttgacaatgcggtttgttcaggataatgaatcgaaatccagtaaaggtgttttg
cggggactacattttcaaaccaaattttcgcaagggaaactggtacgggcaacaaaaggt
gaggtttacgatgtggcggtggaccttcgcaacggatcgcctacttatggacaatgggca
ggagtgctgttaaccgaagaaaataaaacgatgttttatattcccgaagggtttgcccat
gggtttatggttgtttcggaggaagcggtgtttaactataagtgtacgaatctttacgca
ccggaatatgatggcggaatccgctggaatgatccggaagttggcatcgaatggccgctt
gataaaatcgatgacgtattactctcagaaaaagatgaaaagctaccttttttaaatgaa
ataagcgattcgttaagatttgaatag

DBGET integrated database retrieval system