KEGG   Acetobacterium woodii: Awo_c02800Help
Entry
Awo_c02800        CDS       T01732                                 

Gene name
thrC
Definition
threonine synthase ThrC (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
awo  Acetobacterium woodii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:awo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Awo_c02800 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Awo_c02800 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Awo_c02800 (thrC)
Enzymes [BR:awo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Awo_c02800 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(322472..323977)
Genome map
AA seq 501 aa AA seqDB search
MKKGYNSTRSKDINVSASQGILQGLAPDGGLFVPNFINQIQFDPQKLIGKSYGEMANVIF
SAFLNDFTEQQISDAIKGAYYSGKFEDQEPVALKKVNDRYFLELFHGPTCAFKDMALTIL
PYLMVESMKNVNNQKKIMILTATSGDTGKAALEGFADVANISIIVFYPKDGVSTIQEKQM
LTQTGANTCVVGVDGNFDDTQNGVKIILNDSHMAAKLAASNVIFSSANSINIGRLLPQVV
YYFYSYYDLLKRGEIQPDEQINFVVPTGNFGNILAGYYAARLGLPINKLICASNANKVLT
DFFETGQYNRNRDFYKTSSPSMDILISSNLERLLYDLSDCDSDSVKTLMEQLKNDGTYQV
SKTLMEKTQLFYAGTADETETSQAIKSVFDQSSYLMDPHTAVANKVYDDYRKETGDSTKT
VIVSTASPYKFARSVYESIFGACDANDYALLSLLAEKTGTTVPLPLKDLDKKDNHHQSQC
DKTDMSKAVLDFLNHQEHAND
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggctacaacagcactcgatccaaagacatcaacgtttctgcatcccaagga
atcctgcaaggattagccccggatggtggactttttgtccccaactttatcaatcagatt
caattcgatccacaaaaactgatcggaaaaagctacggcgaaatggcaaatgtcatcttc
tccgcgttcctcaatgatttcaccgaacaacaaatttctgatgccattaaaggcgcttat
tattccggtaaatttgaagatcaagaaccggttgctttaaaaaaagtcaacgatcgttat
ttccttgagctctttcatggtccgacctgtgcttttaaagatatggctttgactatttta
ccatatctgatggtagaatccatgaaaaatgtaaataatcagaagaaaataatgatttta
accgctacttccggcgataccggaaaagcggccttagaaggttttgccgacgttgccaat
atcagtattatcgtcttttatcccaaagacggggtcagtaccattcaggaaaaacaaatg
cttacccaaactggtgccaacacctgtgtagtcggtgttgatggaaatttcgatgacact
caaaatggcgtcaaaataattcttaatgattcccatatggccgccaaactggccgcatcg
aacgtcatcttttcatctgctaattcaatcaatatcggccgtttattgcctcaggttgtc
tattatttttatagctattacgacctgttaaaacgcggcgaaattcaacccgatgaacaa
ataaattttgttgtcccaaccggcaattttggcaatattctggccggttattacgctgct
cggcttggtttaccgataaacaaactgatctgcgcctcaaatgcgaataaagtgctgacc
gatttttttgaaaccggtcagtacaaccgcaatcgggatttttataaaacctcatcgcca
tcgatggatattctcatttcaagcaatctggaacgtttgctttatgatttatccgattgc
gattcagattccgtaaaaacccttatggagcaacttaaaaacgatggtacttaccaagtt
tctaaaaccctgatggaaaaaactcagctcttttatgccggtaccgccgatgaaacggaa
acctcacaagcgatcaaatctgtttttgatcaaagcagttatctgatggatccgcatact
gctgtcgccaacaaagtttatgacgactatcgcaaggagactggtgattcgaccaaaaca
gtaattgtctcaaccgccagcccttataagtttgcccgttcggtttatgaaagtattttt
ggtgcctgtgacgcaaatgattatgcattattaagtctgctcgctgaaaaaaccggtact
accgtgcctttaccactaaaagatctggataaaaaagacaatcaccaccaatctcaatgt
gataaaaccgacatgtcaaaagcggttctcgatttcttaaatcatcaggagcacgccaat
gattaa

DBGET integrated database retrieval system