KEGG   Acetobacterium woodii: Awo_c05350Help
Entry
Awo_c05350        CDS       T01732                                 

Gene name
speB
Definition
agmatinase SpeB (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
awo  Acetobacterium woodii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:awo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Awo_c05350 (speB)
Enzymes [BR:awo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Awo_c05350 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
616308..617156
Genome map
AA seq 282 aa AA seqDB search
MLNKNIDTFLGCDNSYSEAQVVVFGAPFDSTTSFRPGTRFASRTMRGESYGLETYSPYQD
KDLEDFAVFDGGDLELCFGDTEKALAAIETYTTAILSDNKLPVMIGGEHLVTLGAVRAVA
RKYPDLQVVHFDAHADLRDDYLGTTLSHATVLHRVWDIIGDNRIYQFGIRSGERREFVWG
KNHVTTQKFNFDGLAAVVDKLQAKPIYFTLDLDVLDPSVFPGTGTPEPGGVSFIELLEAM
LQVTKLNIVGCDINELSPVYDQSGASTAVACKVLRELLLAIV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgttgaataaaaatatcgatacctttttaggttgtgataatagctattcggaagcgcaa
gtggttgtttttggagcgccgtttgactcaaccacatcgtttcggccgggaacccgattt
gccagccggacgatgcggggcgaatcgtatggattggaaacttatagcccttatcaggat
aaagaccttgaagactttgccgtttttgacggtggtgatttggaactttgttttggtgat
accgagaaagctttggcggcgattgaaacctataccaccgctattttaagcgataacaaa
ctgccggtgatgattgggggcgaacatctggtgacgttgggggcggtgcgggcagtggcc
cgaaaatacccggatttgcaggtggttcattttgatgcgcatgccgatttacgagatgat
tacctggggacaaccctttctcatgcaaccgtgttacatcgagtttgggacatcattggc
gataaccgaatctatcagtttggaatcaggtctggggagcgccgtgagtttgtttgggga
aaaaatcatgttaccacccagaaattcaattttgatgggctggcagcagtagttgataaa
cttcaagctaaaccgatttatttcaccctcgatctggatgtgttggacccttcggtattt
cccggcaccggtactccggaacctggcggcgtcagttttatcgaactactggaggcgatg
ttgcaagttaccaagctgaatattgtcggctgtgatatcaacgagttatcaccagtgtat
gaccagagcggagcatcgaccgcggtggcttgcaaggttttaagagaactattattggcg
attgtttaa

DBGET integrated database retrieval system