KEGG   Acetobacterium woodii: Awo_c06310Help
Entry
Awo_c06310        CDS       T01732                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
awo  Acetobacterium woodii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:awo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Awo_c06310 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Awo_c06310 (adhE)
   00620 Pyruvate metabolism
    Awo_c06310 (adhE)
   00650 Butanoate metabolism
    Awo_c06310 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    Awo_c06310 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Awo_c06310 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Awo_c06310 (adhE)
   00626 Naphthalene degradation
    Awo_c06310 (adhE)
Enzymes [BR:awo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Awo_c06310 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Awo_c06310 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
726161..728812
Genome map
AA seq 883 aa AA seqDB search
MLDKKKIKGVIERPETVNSVESLNHRLQEVKAAQRKFASYTQEQVDAIFLAAATAATKNR
IHLAKMAVGETRMGIVEDKVIKNHFASEYIYNAYKETQTCGILEESQAFGIKKIIAPIGV
IAAVIPTTNPTSTAIFKSLIALKTRNGIIFSPHPGARNCTIEAARIVLKAAVAAGAPEGI
IAWIDEPSVELSMEIMKAADVVLATGGPGMVKSAYSSGKPAIGVGNGNTPAIIDATADVL
LAVNSIVHSKTFDNGTICASEQSVVIDTNVYEKCMKEFVERGCYRLDEKEKELVRKIILN
AAGNINAQIVGRTAYQIAQLAGFECPQDTKVLLGEVTELDVTMEPFAHEKLSPILAVYRS
NDFEDGLRIADRLVMDGGVGHTSVLYIDMVKAPDKLKAFEEKMKTSRILVNTPASHGGIG
DLYNFKLLPSLTLGCGTWAGNSVSGNVGVKELLNIKTVAERRENMLWFRTPEKVYFKKGC
TSVALEELKSVYKKKKAFIVTDTFLYKSGFTKSITDQLDDMGIDHHTFFEVTPDPTLECA
KTGAAAISAFEPDVIIAIGGGSAMDAAKIMWILYEHPEVDFADLAMRFMDIRKRVYGFPE
MGKKASMVCIATSSGTGSEVTPFAIITDEKTQTKYSIADYSLLPTIAISDADMMMDQPKG
LTAASGIDVLTHALEAYASMFATDYTDGLALKAAKLVFDYLPRAYQYGRDDMEAREKMAN
ASTIAGIAFANAFLGVCHSMAHKLGAHHHVQHGFANALLITEVMKYNSSETPKKMGTFSQ
YQYPQTLHRYAEVANYLGLPGKNDQEKLESLIAKIEELKACIGVPKSIKEFGVDEQEFLN
NLEIKCEEAFDDQCTGTNPRYPLMSEIKEMYLNAYYGKESKWY
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgttagataagaaaaaaatcaaaggtgtgattgaaagaccggaaacagtaaatagtgtg
gagagtttaaaccatcgacttcaggaggtaaaagcagcgcaacgaaaatttgcatcttac
acgcaggagcaagttgatgctatttttcttgcggcagccacggcggcgacaaaaaatcgg
attcatttagcgaaaatggccgtcggagagactcggatgggcattgttgaagataaagta
attaaaaatcattttgcctcggaatatatttataatgcctataaagagacccaaacctgt
ggtattttagaggaatcacaagcttttggaatcaagaaaataattgccccgatcggagtc
attgcagcagttattcccacgacaaatccgacttcgacagcgatttttaaatcactgatt
gctttgaaaacacgaaatgggatcattttttcaccacatcccggagcccgaaattgcacc
attgaagccgcgcgaattgttttaaaagcggcggttgcagccggcgcgccagaagggatt
atcgcctggattgatgaaccttcggttgaactgtcaatggaaattatgaaagcggcagat
gtagtgctggcgaccggcggaccgggaatggtgaaatcagcttattcatcgggaaaaccc
gcaattggcgtcggcaacgggaataccccggcgattatagatgccacagctgatgtgttg
ttggcagttaattcgattgtgcattcaaaaacgtttgacaatggcaccatttgtgcatcg
gaacagtcggtcgtgatcgatacaaatgtctatgaaaaatgtatgaaagaatttgtcgag
cgggggtgttaccgcttggatgagaaagaaaaagaactcgtcagaaaaatcattttaaat
gctgccggtaatattaatgcccagatcgttggccgaaccgcatatcaaattgcccaactg
gcaggttttgaatgtcctcaggataccaaagtgcttttaggcgaagtgacggaacttgat
gtgacgatggagccatttgcccatgaaaaactgtcgccaattttggcagtataccgcagt
aatgattttgaagacggtctgagaattgccgatcgtttggtaatggacggcggcgttgga
catacctcggtactatatattgacatggtgaaagcaccggataaactaaaagcgtttgaa
gaaaaaatgaagaccagtcgaattctggtcaacacgccagcttctcacgggggcattggg
gatctctataatttcaagctgctaccttcattaacgctggggtgcggaacctgggcaggt
aattcagtatcgggaaatgtcggcgtaaaagaattgttaaatattaagacagtggctgaa
aggcgggaaaatatgctttggtttagaactcctgaaaaagtgtactttaaaaaaggctgc
acaagtgttgcgctagaagaattaaaaagtgtttataaaaagaaaaaagcttttattgtc
acggatacgttcttgtataaaagtggttttaccaaatcaattacggatcaattagatgat
atggggatagatcaccacaccttctttgaggttacgcccgatccaacattggagtgcgct
aaaactggcgcagcagcgatttcagcttttgaaccggatgtgattattgctattggtggc
ggttcggcaatggatgcagctaaaattatgtggattctttatgaacatccagaggttgat
tttgccgatttagcgatgcgttttatggatattcgaaaaagagtttatgggtttcctgaa
atgggcaaaaaagctagtatggtttgtattgctacttcgtcgggaaccggttcagaggtc
acaccgtttgctattatcaccgatgaaaaaacccaaacgaagtattccatcgctgattat
tcgttgttgccaacaattgcaatcagcgatgccgacatgatgatggatcaaccgaaaggt
ttgacggcagcatcgggaattgatgtcttaacccatgctttggaggcttatgcatcgatg
tttgcaacggattatactgatggactggcattgaaagctgcaaaactggtgtttgactat
ctgccaagagcgtaccagtatggacgcgatgatatggaagcccgggaaaagatggcgaat
gcctcaaccattgccgggattgcctttgcgaatgcatttttaggagtttgccattcaatg
gctcataaattgggggctcatcaccatgtgcaacatggttttgccaatgcgttattaatt
accgaagttatgaaatataattcatcggaaacgcctaaaaaaatggggacattttcgcaa
tatcaatatccgcaaacactacatcgttatgccgaggttgccaattatttaggtttgccg
ggaaaaaatgatcaggaaaaactggaaagtttgatagctaaaatagaagaattaaaagcc
tgtattggggttccgaaatcaatcaaagaatttggtgtcgatgaacaggaattccttaat
aatctggagattaaatgtgaagaagcgtttgatgatcaatgtacgggaacaaatccaaga
tacccattaatgagcgaaattaaagaaatgtatttaaatgcttattacggtaaagaatct
aagtggtattga

DBGET integrated database retrieval system