KEGG   Acetobacterium woodii: Awo_c07020Help
Entry
Awo_c07020        CDS       T01732                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
awo  Acetobacterium woodii
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:awo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Awo_c07020
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Awo_c07020
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Awo_c07020
Enzymes [BR:awo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Awo_c07020
Exosome [BR:awo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Awo_c07020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
802098..803909
Genome map
AA seq 603 aa AA seqDB search
MLTAVAMLLFQVPAGVSAEEIIDTSGEKAEELVFEGNCSYQTQIQNIGWQDWKSKESMSG
TTGKSLRLEGIKIKISESPNLGVTYQTQIENVGWQDWVSDGTVSGTEGQSLRLEAIRIKL
TGADAKKYDIYYQVHVQNTGWMNWVKNGELSGTVGESFRLEGIKIMVLPKGTPAPVNTGS
IKNVILMISDGCGANEILATDYYTDGKAGTQTYENFPTKLNMSTYSHGGLGTADDLLSLY
DPKTIWSDFALLNNNPTDSAAAATAMASGTKTYDAAIGVDQDEQKLVNICEDFEAQNKAT
GVITSVEFSHATPAGFVAHNSSRQNYSELANEMIKDSKTDLIMGAGNPLYDNNGKLKTTI
ADSDYKYVGGQDTWESLVAGNLGNDADGDGDIDNWNLIQSKQAFETLQTGAAPDRVIGIP
EVFETLQINRDGDGKAEPFTVAMNENVPTLEVMSKGALNVLDNDPDGFFLMIEGGAIDWA
GHSNLDGRLIEEETDFNHSVDAVCDWVNTNSNWDETLVIVTGDHETGYLTGTTGVYDDVV
NNGKGVMPTMAWNSGNHTNQLIPFFAKGPGAALLENYANGSDPVKGAYLDNSEIALAIRN
LLN
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgttgacggcagttgctatgctgctatttcaagtaccggctggtgtcagtgctgaggag
atcatcgatacgagcggtgaaaaagctgaagaattagtctttgaggggaattgcagttat
cagacgcagatccagaatattggctggcaggattggaaatcaaaagaatcgatgagtgga
acaacgggtaaatcgttgcgtttagaaggaataaaaataaaaatcagtgagtcaccgaat
ttaggggtgacctatcaaacccagattgaaaatgtcggctggcaggattgggtgtccgat
ggaactgtcagcggaacggagggacaatcgctgagattagaagcgatccggattaaactg
accggtgcagatgcgaaaaaatatgatatttattaccaggttcatgtgcaaaataccggt
tggatgaattgggttaaaaatggtgaattatcaggaacggtaggcgaatcattccgattg
gaaggcataaagattatggttttgccaaaaggaacgccggcaccggttaataccggctca
attaaaaatgttattttgatgatctctgatggttgtggtgccaatgagattctggcaacc
gattattacaccgatggaaaagcgggaacgcagacttatgaaaatttcccgacaaaatta
aacatgagtacttattctcatggcgggttggggacggcagatgatttgttaagtttatac
gatcccaaaacaatctggagcgattttgcgttattaaataacaatcccaccgattcggca
gcggcagccacggcaatggcatcgggaacaaaaacctatgatgcggcaattggtgttgat
caggatgagcagaaactggtgaatatctgtgaagattttgaagcccaaaataaagcaacg
ggggtgattacatccgttgagttcagtcacgcaacgccggctggttttgtggcgcataat
tcaagccgacaaaactatagtgaattggcaaatgaaatgattaaagatagcaagacagac
ttgatcatgggggccggaaatccattatatgataataatggtaaactgaagacgaccatt
gcagacagtgactacaaatatgttggcggacaagatacctgggaaagtctggtagcagga
aatttaggaaatgatgccgatggtgacggggatattgataactggaatctgattcagtcg
aaacaagcatttgaaacgcttcaaacgggggcggcaccggatcgcgttatcgggattccg
gaagtctttgaaacccttcaaattaatcgcgacggcgacggtaaagccgaaccttttacg
gtggcaatgaatgaaaatgtaccaactctcgaggtgatgtcaaaaggtgctcttaatgtg
ttggacaatgacccggacggatttttcctgatgatcgaaggtggcgcaattgattgggct
ggtcatagcaacttggatggacgactaattgaagaagaaacggactttaatcattcagtt
gatgccgtttgtgattgggttaatactaacagtaattgggacgaaacactggttattgtt
acgggcgaccatgaaaccggatatcttaccggcacaaccggtgtttatgacgacgttgtt
aataatggaaaaggcgtcatgccgacgatggcctggaatagcggtaaccataccaatcag
ttgattcctttctttgccaagggacccggagcagcattgttagaaaactatgccaacggt
tcagatccggtcaaaggggcttatctggacaacagcgaaattgccttggcaattcgtaac
ttacttaactag

DBGET integrated database retrieval system