KEGG   Acetobacterium woodii: Awo_c07630Help
Entry
Awo_c07630        CDS       T01732                                 

Gene name
trpB1
Definition
(GenBank) pyridoxal-phosphate dependent tryptophan synthase beta subunit TrpB1
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
awo  Acetobacterium woodii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:awo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Awo_c07630 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Awo_c07630 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Awo_c07630 (trpB1)
Enzymes [BR:awo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Awo_c07630 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(878708..880081)
Genome map
AA seq 457 aa AA seqDB search
MEKIPYKIYLSEDEMPKYWFNLRSKMKELPEPFVNPGTGEYCTKEELLPVFCEDLVDQEL
NTTDTYIEIPEEIRNYYKMYRPSPLVRAYSLEKALDTPAEIYYKYEGTNTSGSHKLNSAA
AQAYYAKKQGLSSLTTETGAGQWGTALSMACAHFNLDLSVYMVKVSADQKPHRRAVMETY
GAKVIASPSNTTNVGRKILAETPDTNGSLGCAISEAIEVAVTTDSCKYVLGSVLNHVGLH
QSIIGLETKTACDKYDIKPDIIIGCAGGGSNLLGLIAPFMADKIEGKNDIDFVAIEPASC
PSLTRGRYALDFGDTGKTTPLIRMYTLGSGFMPSPNHAGGLRYHGMSPIISKLYHDGYIR
AKSYIQNEVFEAAVQFARIEGILPAPESSHAIKAAIDEALACKESGEKKTIIFGLTGTGY
FDMTAYTNYNSGNMTDYIPTDEDLQKGFDSLPQVNQK
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagattccctacaaaatttatttaagcgaagatgagatgcccaaatactggttt
aatctccggtcaaaaatgaaagaactgccggaaccttttgttaatcccggaactggcgaa
tactgtaccaaagaggagctgcttcccgttttctgtgaagatctcgtcgatcaggaactg
aacaccaccgatacatatattgaaatccctgaagaaatccgcaattattacaaaatgtat
cgtccctccccattggttcgcgcctattctttagaaaaagctttggatacccccgcggaa
atttactataaatatgaaggtaccaacacttccggatcacataagttaaactccgccgcc
gctcaggcctattacgctaaaaaacaagggttatcctccttaaccactgaaaccggagcc
ggacaatggggaaccgccctttccatggcctgcgcccattttaatctggacttatcggtt
tatatggttaaggtttctgccgatcaaaaaccccaccgccgggcagttatggaaacttac
ggggctaaagtgattgcctcaccttccaacaccaccaacgtcggccgaaaaattctggcc
gaaacccctgatacgaatggatctttaggctgtgccatcagtgaagccattgaagtcgcc
gttaccaccgatagttgtaaatatgtcttgggtagcgtcttaaaccatgttggcctccat
cagtcgatcatcggactggaaacaaaaacagcctgcgataaatatgatatcaaacccgat
atcattattggctgcgccggtggcggttccaatttattaggtttaattgctccctttatg
gcagataaaattgaaggtaaaaacgatatcgattttgtcgccattgaacccgcttcctgt
ccatcgttaaccaggggacgttatgcccttgattttggcgacactggtaaaacaacgccg
ttaatccgaatgtacacccttggcagcggctttatgccctcccctaaccatgccggcgga
ttacgttaccatggcatgagcccaattatttcgaaactttaccacgacggttatatccgg
gccaaatcatatattcaaaatgaggtctttgaagccgcagtccaatttgcccgaatcgaa
ggaattctccccgctccggaatcttctcacgccattaaggccgccattgatgaggccctg
gcctgtaaagaatccggtgaaaagaaaaccattatctttggtttaaccggaactggctac
tttgatatgaccgcttatacgaactacaattctggtaatatgaccgactatatcccaacc
gatgaagatctgcaaaagggttttgacagcttgccgcaggttaatcaaaaataa

DBGET integrated database retrieval system