KEGG   Acetobacterium woodii: Awo_c08060Help
Entry
Awo_c08060        CDS       T01732                                 

Gene name
fpb
Definition
(GenBank) fructose-1,6-bisphosphatase Fpb
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
awo  Acetobacterium woodii
Pathway
awo00010  Glycolysis / Gluconeogenesis
awo00030  Pentose phosphate pathway
awo00051  Fructose and mannose metabolism
awo00680  Methane metabolism
awo01100  Metabolic pathways
awo01110  Biosynthesis of secondary metabolites
awo01120  Microbial metabolism in diverse environments
awo01130  Biosynthesis of antibiotics
awo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:awo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Awo_c08060 (fpb)
   00030 Pentose phosphate pathway
    Awo_c08060 (fpb)
   00051 Fructose and mannose metabolism
    Awo_c08060 (fpb)
  Energy metabolism
   00680 Methane metabolism
    Awo_c08060 (fpb)
Enzymes [BR:awo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Awo_c08060 (fpb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: AFA47600
UniProt: H6LB48
Position
complement(926436..928430)
Genome map
AA seq 664 aa AA seqDB search
MNGYTKVQLQENKKYLELLSQSFPNITSAVGEVVNLKAILNLPKGTEHFLTDIHGEHEAF
NHVMQNASGAIKRKVHQELGNTIAFEDLEELSTLIYYPEQKIDLIKKERSQESLDNWYKL
TIYRLVKVCRAAASKYTRSKVRKALPKDFAYIMEELLQEDEHRFNKREYYQEIIESLVKL
ERAQHFIVEISGVIKRLTIDHLHIIGDIYDRGAGPDEVMDTLMRHHSLDMQWGNHDILWM
GAAAGNAACIANAVRIALRYANMDVLENGYGINLLPLASFANRVYSDDPCAKFTPKLSDN
HSVSDQEISLMAKMHKAIAIIQFKLEEVLIDNHPDYHMEKRQLLRCIDFENKTVTVEGIV
YPLNDTNFPTLDPDSPYTLTEEENLVIDRLIYAFLHSEKLQKHIRFMYAKGSMYKVFNSN
LLFHACLLINADGSFKAKEIAGKKYAGKNLMDKFDQMAREAYFGQTDKDNNQTRTDFLWF
LWCHEDSPLFGKDKMATFERYFIDDKEPHKERYAPFYLLIDDDDELAKRILVEFGVDPEE
GHLINGHIPVKATSGESPIRAKGKQLVIDGGFAKAYQKTTGIAGYTLTYNSYGLILISHD
PFESVEKAIADGVDIKSTLMVVEKSTERKRVRDTDTGKALMNQVEDLEMLITAYRKGLIK
EKQF
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgaacggttatacaaaagtacaactccaagaaaacaaaaaatatctcgaactactgtca
caaagttttcccaacattaccagtgccgtgggagaagttgttaaccttaaggcgattcta
aacctcccgaaaggaacggaacattttcttaccgatatccatggggaacatgaagccttt
aatcatgtcatgcaaaacgcttctggagcgatcaaacgaaaggttcatcaagagctggga
aatacgattgcatttgaagatttggaagaattatccacccttatttattatcctgaacaa
aaaattgacttaattaaaaaggagcgtagccaggagtctttggataactggtataaactg
accatttaccgcctggttaaagtttgtcgggccgcggcttcaaaatacacccgctctaag
gttcgtaaagcattgccaaaagattttgcttacatcatggaagaattactgcaagaagat
gagcatcgttttaacaaacgtgaatactatcaggaaattattgagagcctggtcaaattg
gaacgcgctcaacactttatcgtggagatctctggcgtcatcaaacgactgacgatcgat
caccttcatattatcggggatatctacgaccgtggtgccggacctgatgaagtaatggac
accctgatgcgtcatcattcccttgatatgcaatggggaaaccatgatattctctggatg
ggtgccgctgccggcaacgccgcctgtattgccaatgccgttcgaatcgccttacggtat
gctaatatggacgttctggaaaacggatatggtattaatctcttaccgctagcttccttt
gccaaccgggtttacagcgatgacccctgtgctaagttcacccctaaactctcggataat
catagcgtttccgaccaggaaatttccctgatggcgaagatgcataaagccattgcgatt
attcaatttaaacttgaagaagtattgattgataatcatcctgattatcatatggaaaaa
cgtcaactgcttcgctgtatcgattttgaaaataaaacggtgaccgttgaaggcattgtt
tacccgcttaatgatactaattttcccacccttgaccccgatagtccctacacgttaacc
gaagaagaaaacctggtgattgatcgcctgatttatgcctttttacacagtgaaaaactt
cagaagcatattcgttttatgtatgccaaaggaagtatgtataaggtttttaatagtaat
ttgctgtttcatgcctgccttttaattaacgctgatggaagctttaaagctaaagaaatc
gccggaaaaaaatacgccggaaaaaatttgatggataaattcgaccagatggctcgagaa
gcttattttggtcaaactgacaaagataacaatcagacgcgaaccgattttctctggttc
ttatggtgtcatgaagattctcctctttttggaaaagacaaaatggccaccttcgaacga
tattttatcgatgataaagagccccataaagaacgttatgcgcctttttatttattgatt
gacgacgacgatgagctggctaaaagaatcttagttgaatttggtgttgatcccgaagaa
ggtcatctgatcaatggacatattcccgttaaagcaacgtctggagaaagcccgatccgt
gccaaaggtaaacagttagtgattgacggcggttttgccaaagcctatcaaaaaacaacg
ggtattgccggttataccttaacttacaattcttatggtttaatcttgattagtcacgat
cccttcgaatcggttgaaaaagcgattgccgatggtgtcgacattaaatctactttaatg
gttgtcgaaaaatcaactgaacgaaagcgggttcgcgataccgataccggcaaagcattg
atgaatcaggtcgaagatctggaaatgttaattacggcttaccgcaaaggtctgatcaaa
gaaaaacaattttaa

DBGET integrated database retrieval system