KEGG   Acetobacterium woodii: Awo_c08790Help
Entry
Awo_c08790        CDS       T01732                                 

Gene name
celA
Definition
cellulase CelA (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
awo  Acetobacterium woodii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:awo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Awo_c08790 (celA)
Enzymes [BR:awo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Awo_c08790 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1014349..1016262
Genome map
AA seq 637 aa AA seqDB search
MKKSYLIILILVLSAVFMSSCVSAADKNETVTEIGVAYRGHVQDYGNCPTDGTWVEDGNM
LGTTGESKRIEGFWIKLTGNDQLPAGTSIRYNVHVQNQGWLASTDLNQVSNWIADGDFAG
SQGKGQRVEAIQIILLGADGLQLPDYSVVYSVHGQDYGWSQGWKKDGEIAGETGQSRRLE
SIRIKIINKDEAITDQTPVAEHGMLSVVGTQLTDKNGAAFQIKGVSTHGLSWFPEYVNAN
AFETMRDEWGINAVRLAMYTTEYNGYCTGDENNRALLKQQVEKGVNLATDLGLYVIIDWH
ILSDGNPETHQAEAIAFFDEMAERFKDNHNVIYEICNEPNNGTSWNQIKGYAEKVIPVIK
AHNQDAVILVGTPTWSQDVDQAAADPISGYSNIMYTLHFYADTHREGLRNKMVAAIEKGL
PIFVSEYGICDSSGNGPINEEEASKWMDVLNQYGVSQIAWNLSNKNETSALIRNDCSKTG
NWRESELSASGQWLVKMLGKEKELGSGQASNPGDGGNTPPVVENPPDENDSSGNEAAVAT
VKMTNSWSDGSNYYYQYAITINNQSAVDLNDWKIKLTFPGAITVDQNWNAQMELRDQVVW
LSPVDYNQNIPAGKVINDIGCIIYSPQTMGAPMVALE
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagagttatttgattattttgattttggtactgagtgctgtctttatgtcgagt
tgtgtttcagccgctgacaaaaacgaaacggtgactgaaataggggtcgcttaccgtggt
catgttcaggattatggcaattgtcccaccgatggaacgtgggtggaagatggaaacatg
cttgggactaccggagaaagtaagcggattgagggattttggatcaagctgaccggaaac
gatcaattaccggcgggaaccagcatccgatacaatgttcatgtgcaaaatcagggatgg
ttggcttcaactgatttaaatcaagtaagcaattggattgcagatggcgattttgccgga
tctcaaggtaaaggtcaacgcgtcgaagccattcagatcattcttttaggtgcagatggt
ctacaattgcctgattattccgttgtttatagtgttcatggccaggattatggttggtcg
caagggtggaaaaaggatggtgaaattgccggcgaaacgggtcagtcccgacggttggaa
tcgattcggattaaaattatcaataaagatgaggccataacagatcagacaccggttgct
gaacatggcatgctatcagtggttgggactcaactgaccgataaaaatggtgcggccttc
cagataaaaggggtatcaactcatggtctttcctggtttccggaatatgttaatgccaat
gccttcgaaacgatgcgggatgaatggggcattaatgcggttcggttggctatgtatacc
acagaatataatggctattgcacgggagacgaaaacaaccgggcattgctgaagcaacag
gttgaaaaaggggttaatctggctactgatttggggttgtatgtgatcatcgactggcat
attctcagtgatggcaaccctgaaacccatcaggccgaagcgattgctttttttgatgag
atggcagagcggttcaaagacaatcataatgttatttatgaaatctgcaatgaaccaaac
aatggaacgagctggaatcagattaaggggtatgccgaaaaggtgattcccgtgatcaaa
gctcataatcaggacgccgttatccttgttggcaccccaacctggtcacaggatgtcgat
caggcggcagccgatcctatttccgggtattccaatatcatgtatacccttcatttttat
gccgacacccatcgggaagggttgcgaaataaaatggttgccgcaattgagaagggactg
ccgatctttgtcagtgaatacggcatttgtgattcctcgggaaatgggccaatcaatgaa
gaagaagccagcaagtggatggatgtattaaatcagtatggggttagtcagatcgcttgg
aacctatcaaataaaaatgaaacctccgcgctgattcgcaacgattgcagtaaaaccggt
aattggcgggaatccgaactttcagcttcgggacagtggctggtcaaaatgctgggtaag
gaaaaagaactggggtctggccaagcttctaatccgggtgacggtggtaacacaccgcca
gttgtagaaaatcctcctgatgaaaatgattcgtcggggaacgaagcagcagttgccacc
gtcaaaatgacaaattcatggtctgatggcagtaactattattaccaatatgccatcacc
attaataatcagagtgctgtggatctcaatgactggaaaataaaattaacattcccggga
gcgataaccgttgaccaaaattggaatgcacagatggaattaagggatcaagttgtctgg
ttatcaccggttgattataatcaaaacattccggcgggcaaggtgatcaatgacattgga
tgtattatttattcgccacaaacaatgggcgcaccaatggttgctttagaatag

DBGET integrated database retrieval system