KEGG   Acetobacterium woodii: Awo_c08970Help
Entry
Awo_c08970        CDS       T01732                                 

Gene name
tpiA1
Definition
(GenBank) triosephosphate isomerase TpiA1
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
awo  Acetobacterium woodii
Brite
Enzymes [BR:awo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     Awo_c08970 (tpiA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1039291..1040064)
Genome map
AA seq 257 aa AA seqDB search
MKKFLLGTNWKMNKTLADATQYTNDLMPIIEKYPAFDFFIIPSYTHLWKLKELIDTNKSA
LKLGAQNMHYADSGQFTGEISPVMLKEIGLDIIELGHCERRQYFNETDETVNLKTLAALK
HGFIPLICIGEKSEDKNYGVSKEMLAKQLKIALKDVPSDKIGQFWVAYEPVWAIGVNGIP
AETPYVKKIHDFLRTVLIELYGPLGKDVPLLFGGSVNINNAKDYAGLENVDGLFIGRSAW
EPDLFEEIMVSVGDTLK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtttttgcttggtaccaattggaaaatgaacaaaaccctggccgatgctacg
caatacaccaatgatctgatgccaatcattgaaaagtatcccgcctttgatttttttatc
attccatcttatacccatttatggaaattaaaagaactgattgatacaaataaaagcgcc
ctgaagctgggcgctcaaaatatgcattatgccgatagtggccaatttacgggtgaaatt
tctcccgtaatgctaaaagaaattggacttgatatcattgagctggggcattgcgaacgc
cggcaatattttaatgaaaccgacgaaactgtcaatcttaaaaccctggccgctttaaaa
catggttttatcccactgatttgtattggtgaaaaatcagaggataaaaactatggtgtt
tctaaagaaatgttagccaaacaattaaagatcgccttgaaagatgttccgtccgataaa
atcggacaattttgggtcgcctatgaaccggtatgggctattggtgtcaatggcattccg
gccgaaacaccttacgttaaaaaaatccacgatttcttacgaactgttctgatcgaactt
tatggaccgcttggtaaagatgtgcccctgctttttggcggcagtgtcaacattaataat
gccaaagactacgccgggcttgagaatgtggatggcctctttattggtcgtagtgcctgg
gaaccagatctttttgaagaaattatggtttcggttggagacacattaaaataa

DBGET integrated database retrieval system