KEGG   Acetobacterium woodii: Awo_c10330Help
Entry
Awo_c10330        CDS       T01732                                 

Gene name
chlI1
Definition
magnesium chelatase 67 kDa subunit ChlI (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
awo  Acetobacterium woodii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:awo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Awo_c10330 (chlI1)
Enzymes [BR:awo01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Awo_c10330 (chlI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1197537..1199495
Genome map
AA seq 652 aa AA seqDB search
MNNTVFPFVAIVGQEEIKNALIWNVVNPEIGGVLISGEKGTAKSSLARGVCKLTADTELV
ELPLNTTEDRLLGNIDFEHAIKFGERRFEAGILKKADGNLLYVDEVNLLSDHLVKSLLEA
ASSGENIIEREGMSYRHAANFVLVGSMNPEEGGLRPQFLDRFGLYVEVKGEADTRVRAEI
VRRRIDYERNPLAFEQKWQDQIVELSNRIERAREDLSKVVVSDNAMQLAASVVNEANCAG
HRAELVIIETAKAIAAMDSRKMLNINDIKEAAKYALPHRIRENNDQPEASPPPPESEEEQ
EEQEEQEEQEEQEQEQNESGNESEEPQDRSEQTNDQADEPEENPEPESDSEMPEDPANDQ
TEPDDDFFQCGEETLDSPEQIFQIARWMSETDKGTISKGSGKRSLMVTSSLQGRYVRNRC
PVKGDIKDIAIDATLRTAAPYQRYREKNGMAIAINQSDIRVKIREKRTGNTIIFVVDASG
SMGANKRMKAVKGAVISMLNDAYQKRDKVGMIVFKNHSAELVLGVTRSVELAEKKLTALP
TGGRTPLAAGLDMAFEVVKAGKIKDKDMLPVIVLISDGRATYSDRGKDAFEEAMKAAGRI
RAEKIKTIVIDTDQNFIKLNLAEKLAVQMNADRYQIEELQANSLMTAVALSL
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaataatacagtttttccatttgtggccattgttggtcaggaggaaataaaaaatgcc
ttaatatggaatgtggtcaaccctgaaattgggggcgtgttgatcagtggtgaaaaagga
acggcaaaatcatcgttggccagaggggtctgcaaattgaccgctgataccgaactggtt
gaactgccgctgaatacgaccgaagatcgcctgcttggtaacatcgatttcgaacatgcc
atcaaatttggagaacggcgttttgaagccgggattcttaaaaaagccgatggcaattta
ttatatgtcgatgaggttaatcttttgagtgatcatctggttaaatcactgctggaagcg
gcgtcatccggtgaaaacattatcgaaagagaaggcatgtcctatcgacatgccgcaaat
tttgttttggttggtagtatgaatccagaagagggcgggttgcggccgcagtttctggat
cggttcggtttgtatgttgaagtaaagggggaggctgatacccgggttcgggctgaaatt
gtccggcgacggatcgactatgaacggaatccgcttgcttttgaacaaaaatggcaggat
cagattgttgaactgagtaatcggattgaacgggccagagaggatttgagtaaggttgtc
gtgtcggataatgccatgcagctggccgcctcggtggtgaatgaagccaattgtgccggt
catcgggcggaactggtgatcatcgaaacggccaaagcgattgcggctatggattcccga
aaaatgttgaacatcaatgatattaaagaagcagctaaatatgccctgccgcaccggatt
cgggaaaataatgatcagccggaagcttcgccaccgccaccagaatcagaagaagaacaa
gaagaacaagaagaacaagaagaacaagaagaacaagaacaggaacaaaacgaatctggt
aatgaatcggaagaaccgcaagacagatcggaacagactaatgatcaggccgatgaaccg
gaagaaaacccggaaccggagtcggattctgaaatgccggaagatcccgcaaatgatcaa
actgagccggatgatgacttttttcagtgcggagaagaaaccttggattcgccagagcag
atctttcaaattgctcggtggatgtctgaaacggataaaggtaccatttcaaaaggaagc
gggaaacgcagcctgatggtaacctcatcgctccagggacgatatgttagaaatcgttgt
ccggtcaaaggagacatcaaggatatcgccattgatgcgacgcttcgaaccgccgcacct
tatcaacggtatcgcgaaaaaaatggcatggccattgcgattaatcaatcggatatccgg
gtcaagatccgcgaaaaaagaacggggaataccattatttttgtggtcgatgccagtggt
tccatgggcgctaacaaaaggatgaaggctgttaaaggagccgttatctcgatgcttaac
gatgcctatcagaagcgggataaggtggggatgatcgtttttaaaaatcattccgctgaa
ttggttttgggagtcacccgcagtgtcgaactggcagaaaagaaactgacagccttgcca
accggcggtagaacacctctggcagctggtcttgacatggcctttgaagtggtgaaagct
gggaaaattaaggacaaggatatgttaccggtgattgtgctgatttccgatggtcgggca
acctatagtgatcgcggcaaagatgcctttgaagaagcgatgaaagcggccggtcgaatt
cgggctgaaaagatcaaaaccattgtgattgataccgatcagaattttataaaacttaat
ctggctgaaaaactggccgttcagatgaatgccgaccgttatcagattgaagaacttcag
gccaatagtctgatgactgccgtagcattatcgctataa

DBGET integrated database retrieval system