KEGG   Acetobacterium woodii: Awo_c10340Help
Entry
Awo_c10340        CDS       T01732                                 

Gene name
chlI2
Definition
magnesium chelatase 38 kDa subunit ChlI (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
awo  Acetobacterium woodii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:awo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1199538..1200572
Genome map
AA seq 344 aa AA seqDB search
MKKNIKIYPFTAIVGQEKMKLALILNVINPSLGGVLIRGEKGTAKSTAVRALADLLPERN
QIEACKFSCDPLNKDQACAECLEKIKTKKINTIQAKMKVIDLPVSATEDRVVGTLDIEHA
IKKGEKRFEPGILAQANRNILYVDEVNLLDDHVVDILLDSAAMGVNTIEREGISFTHPAK
FTLVGTMNPEEGDLRPQLLDRFGLVVDVIGEGDISQRVEVIKRRLDFEKESDSFHQEFNQ
EQTTLADTILKAIEFLPDVTFDEQLLEIIAKISTALGVDGHRADIVMMKTAMTIAAYHGR
AEVTKEDVKEAAGYVLPHRMRKRPFDDSQFNRGSIEEIVNELVG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaacatcaaaatttacccatttactgctattgttggacaggaaaaaatgaaa
ctggcattgattctcaatgtcatcaatccttcattgggtggggtattgatccgcggcgaa
aagggaaccgccaaatcaacggccgtgcgagccctggcagatctgctgccggaacggaac
cagatcgaagcttgcaagttttcatgtgatccattaaataaggatcaggcttgtgccgaa
tgtcttgaaaaaataaaaactaaaaaaatcaataccattcaagcaaaaatgaaggtcatt
gacctgcctgtgagtgcgactgaggatcgcgttgtcggaacacttgatatcgaacatgca
attaaaaaaggcgaaaaacgttttgaaccgggcatccttgctcaggcgaatcggaatatt
ctttacgttgatgaagtgaatttgttggacgatcacgtggttgatattctattggattcc
gcggccatgggggtcaataccattgaacgggaaggcatttcatttacgcatccggctaag
tttaccctggttggtacgatgaatcctgaggaaggggatttacggcctcaacttctggat
cggtttggattagtggtagatgttatcggcgaaggcgatattagtcagcgagttgaagtc
atcaaaagacggttggattttgaaaaagaatctgattcttttcatcaggaatttaatcag
gaacagacaacattggcggatacgattctaaaagccattgagtttctaccagatgtgact
tttgatgagcagttactcgaaattatcgcaaaaatatcaacggcccttggggtagatggt
caccgggctgatattgtcatgatgaagaccgcgatgacgattgctgcctatcatggtcga
gccgaagtgaccaaagaagatgtcaaagaggctgctggttatgtactgccgcatcggatg
cgcaaacggccttttgacgattcccaattcaatcgcggcagtattgaagaaattgtcaat
gaattggtcggctag

DBGET integrated database retrieval system