KEGG   Acetobacterium woodii: Awo_c10910Help
Entry
Awo_c10910        CDS       T01732                                 

Gene name
folBK
Definition
dihydroneopterin aldolase/2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase FolBK (EC:2.7.6.3 4.1.2.25)
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
awo  Acetobacterium woodii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:awo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1257657..1258475)
Genome map
AA seq 272 aa AA seqDB search
MDKLYIKDFEVFAYHGVFPEEKTLGQKFLISVTLSLDMQEAALTGDLTKSVHYGELCHAL
EIEFTKESYDLIETAGEKLATYVLEHYPMVDHVKIMIKKPWAPILKSMDTVAIEINRGWH
VAFIGLGTNMGNREQNLSEAIAHIKSTSGIKIITQSSIIETEPWGYTDQDFFLNCVLKVK
TTLPPHPLMTLLLEIEHGLKRERTIHWGPRTIDLDILFYDHLISDDPHVVLPHPRVQERA
FVMASMAEIAPYFVHPLLNKRMNEIFENLQNN
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactctatataaaagattttgaagtttttgcctaccacggcgtctttcctgaa
gaaaaaaccctgggacagaaattcttaatttcggtcacactctcattggatatgcaagaa
gccgctcttaccggtgatttgaccaaatccgttcattatggcgaattatgtcatgcgtta
gaaattgagttcacaaaagaaagctacgatcttattgaaaccgctggcgaaaaactggca
acctatgttcttgagcattatcccatggttgaccatgtcaaaattatgattaaaaaaccc
tgggcaccaatcttaaaatcaatggacactgtcgccatcgaaatcaatcgcggttggcat
gttgcctttattgggttggggacaaatatgggcaatcgcgaacaaaatttaagtgaagcc
attgcccatattaaaagcacctccgggatcaaaattattacccaatccagcattatcgaa
accgaaccctggggttataccgatcaggatttttttctcaattgtgtcctgaaagttaaa
accactttgccgccgcatccgctcatgacgttactgcttgaaatcgaacacggtcttaaa
cgggaacgaacgatccattgggggccacgaaccatcgatttggacatcttattttatgat
cacctgattagtgatgatcctcatgttgttcttccccatccgcgtgttcaagagcgggct
ttcgtgatggcctcaatggctgaaatcgccccctattttgtccatccgttgttaaataaa
cggatgaacgaaatttttgaaaaccttcaaaacaattaa

DBGET integrated database retrieval system