KEGG   Acetobacterium woodii: Awo_c12420Help
Entry
Awo_c12420        CDS       T01732                                 

Gene name
for
Definition
tungsten-containing formaldehyde ferredoxin oxidoreductase For (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
awo  Acetobacterium woodii
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:awo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Awo_c12420 (for)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Awo_c12420 (for)
Enzymes [BR:awo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Awo_c12420 (for)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1448184..1450235
Genome map
AA seq 683 aa AA seqDB search
MDKLYGYVGKIARINLTDSTVEEINTSDYVPKYIGGRSVCNKIFWDEVGPGVEAFDPENK
IIYMTGPTTATGIPTGGRSVMTGISPNSFPEQYSWSGIGGWFGAEVKFAGYDGLIIEGKA
EEPTYLYIEDGQIQFLSAKNLWGKLVHDSQNKLAEIHGKSVNSIVIGPAGENLMRNASIT
TSNDNVAAKSGFGAVFGSKNLKAITVKGSGEVIPASVEKVLELRNKMAAPLMKPLPVKHE
PGHSIGPANFAEAKGGFNKAYVACSHGCNQHCNMLMLDMKSAFKEEKVNHVEKCVSVFAF
GFEEDVPYGGPGDTFATKLNHTLACKMIPREVGPPDESDPHFKEMFNFQRGDKLDFWKPD
FDKGSVINDLCNEYGVDKWDVIIWLLTWLAMGKKEGVFDDIDFGMEIDVESEEFVKYMMD
MIVYRKGYYGDLLAEGMARAIRTLGKEKFGDTIYQGRFSQMMPGTRLDLPISLESAWGHC
VHWQGRGFEASMEKPAWVATNLHQMNSTRDTQTIAHHHDYFENYLELKDDPCRSPLTARA
VIMGENKAEIKDSVTCCDWQSPDLFWTDMEAQMFEAATGFKMTEKELDEAAERSKLLFRA
IIIRNYGRDRKMEVDAIFPIMQYPDPWGKTVTWDEWNDLVDIYYQERGWDKTTGWPTREV
YTKYGLSFVADELEKIGKLPNLS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggataaattatacggatacgtgggaaaaattgcccgcattaatctgaccgatagcacg
gttgaagaaattaacacttcggattatgtgcccaaatatattggcggacgaagtgtatgc
aataagattttctgggacgaggttgggcctggggttgaagcttttgatccggaaaataag
atcatttatatgacgggaccgacgactgctaccgggattccaactgggggacgaagtgtc
atgacagggatatcaccgaatagttttccggaacagtattcctggagtggcattggtgga
tggtttggggccgaagttaaatttgcaggttatgatggtttgatcattgaaggtaaagcc
gaagaaccgacttatttatatattgaggatggtcagattcaatttttatcagccaaaaat
ctttggggaaaactagtccatgattctcaaaataaattagccgaaattcatggcaagagt
gtaaatagcatcgtgattggccctgccggtgaaaacttaatgcgtaatgccagcatcacc
acaagtaacgacaatgttgctgcaaaaagcggatttggcgctgtttttggctcgaaaaat
cttaaagccattactgttaaaggttccggcgaggtcatcccggctagtgttgaaaaagtg
ctggaattgcgcaataaaatggcagcacccttaatgaaaccgctgccggttaaacacgaa
ccgggacacagtattggtccggcaaattttgccgaggcgaaaggcggatttaataaggct
tatgtcgcctgcagtcatggttgtaatcagcattgtaatatgctgatgttggacatgaag
tcggcgtttaaagaagaaaaagttaatcatgttgaaaaatgtgttagcgtttttgccttt
ggttttgaggaagatgttccatacggcggaccgggtgatacttttgccaccaaactgaac
catactcttgcctgcaagatgattccccgggaagttggtcctcctgacgaatcggaccca
cattttaaagaaatgtttaattttcaacggggcgataaacttgatttctggaaacctgat
tttgacaaaggcagtgttatcaatgatctgtgcaatgaatatggcgttgataaatgggat
gtcattatctggttattgacatggctggcgatgggcaaaaaagaaggtgtttttgatgat
attgactttggcatggaaatagatgttgaaagtgaagaatttgtcaaatatatgatggat
atgattgtttatcgtaagggatattatggcgatctactggctgaaggaatggcacgggcg
attcgaacactgggaaaagaaaaatttggtgatacaatttatcagggccgtttttcacaa
atgatgcccggaacacgattggatctgccaatcagcctcgaaagtgcctggggtcattgt
gttcactggcagggacgcggttttgaagcgtcaatggaaaaaccagcctgggtagctaca
aatttgcatcaaatgaattcgacccgcgatacccagacgattgctcatcatcatgattat
tttgaaaattatttagagcttaaggatgatccatgccgaagcccgcttactgcccgagca
gttattatgggagaaaataaggccgaaataaaagattccgtcacctgctgtgactggcag
agccccgatcttttttggaccgatatggaagcgcagatgtttgaagcagcaaccggtttt
aaaatgaccgaaaaagaattggatgaagcggccgaacgttccaagttgttatttcgagcc
attatcattcgtaattatggacgtgatcgaaagatggaagttgatgctattttcccgatt
atgcaatatcccgacccttggggaaaaacagttacttgggatgaatggaatgacctggtc
gatatttattatcaagaacgtggctgggacaaaacaaccggttggccgacccgcgaagtt
tatactaagtatggattatcttttgtggctgacgaactggaaaaaatcgggaaactgcca
aacttgagttaa

DBGET integrated database retrieval system