KEGG   Acetobacterium woodii: Awo_c12530Help
Entry
Awo_c12530        CDS       T01732                                 

Gene name
pdhC1
Definition
(GenBank) pyruvate dehydrogenase E2 component, dihydrolipoyllysine-residue acetyltransferase PdhC1
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
awo  Acetobacterium woodii
Pathway
awo00010  Glycolysis / Gluconeogenesis
awo00020  Citrate cycle (TCA cycle)
awo00620  Pyruvate metabolism
awo01100  Metabolic pathways
awo01110  Biosynthesis of secondary metabolites
awo01120  Microbial metabolism in diverse environments
awo01130  Biosynthesis of antibiotics
awo01200  Carbon metabolism
Module
awo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:awo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Awo_c12530 (pdhC1)
   00020 Citrate cycle (TCA cycle)
    Awo_c12530 (pdhC1)
   00620 Pyruvate metabolism
    Awo_c12530 (pdhC1)
Enzymes [BR:awo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Awo_c12530 (pdhC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AFA48037
UniProt: H6LDZ4
Position
1458570..1459796
Genome map
AA seq 408 aa AA seqDB search
MAKLMNMPKIGVNMTDGTITEWYVNEGDEVKFGEMALAAETDKDVQDIPADQTGTVLKIM
AQVGDNVECHKPLAIVGTPGENIDSLLAEISNGGIPTASAEVVAAAPVQSTEVAQAPSTG
RVPVSPLAKKMAKDLGIDLSDVKYTGVRVTKSDILAYEKQPEESAAVVSPIAVNPVLPDQ
GIRKTTPYTGMRKKIGSRLTESVVTKPWAALSVAVDMTKAIEWRKRVNEIADVKVGFNEM
VAKACARALQEYPMMNAQLAAEGTDIYEMEEINIGIAVNTDRGLMVPVLKNVATKGVVEL
AKEFAGLVSRTKEQANIQGDLSGGTFTISNLGARGISSFRAVINPPECGILALAATIKTP
VVIDDEIVIRPMMNITLSFDHRIVDGDYAAQFVAYIGNLLEDPMKILM
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattaatgaatatgccaaagatcggcgttaacatgactgacggtacgattacg
gaatggtatgtaaacgagggtgacgaagtaaagtttggcgaaatggcgctggcggcggaa
accgacaaagacgttcaggatattcctgcagatcagacagggacagttttaaaaattatg
gcgcaagtgggcgataacgtagaatgtcataaaccgctggcaattgtgggtacccctggc
gaaaacatcgacagtttattagctgaaataagtaatggcggaattccgacggcatctgcg
gaagtagttgcagctgcaccggttcaatcaactgaagttgcacaagcaccttcaaccgga
cgcgttcccgtttcaccattagctaaaaaaatggccaaagatttgggaatcgatctaagt
gatgttaaatataccggtgttcgggttacaaagtctgatattttagcttatgaaaaacaa
ccggaagaatcagcagccgtcgtttcgccgatagctgttaatcccgttttaccagatcaa
gggattcgaaaaacaacaccatataccggcatgcgcaagaaaattggcagccgcctgaca
gaaagtgttgtaaccaaaccgtgggcagcgctttcagtggcagttgatatgacgaaagct
atcgaatggcgaaaacgcgttaatgaaattgctgatgtaaaggttggttttaatgaaatg
gtagccaaagcctgtgcgcgggctttacaggaatatccgatgatgaatgcacaactggca
gcagagggcacggatatttatgaaatggaagagattaacattgggatcgcggtaaatact
gatcggggcttaatggttccggtgctgaagaatgttgcaaccaaaggggtagtagaactg
gcaaaagaatttgctggtttagttagccgcacaaaagaacaagcgaatatccaaggcgat
ttatcgggaggaacgtttacgatcagtaatctgggtgcccggggaatttcaagtttccga
gccgttattaatcccccggaatgtggaattctggctttagccgccacgatcaaaaccccg
gttgtgattgacgatgaaattgtgattcgaccaatgatgaatattacgttgagttttgat
caccggatcgttgatggggattacgcagcacagtttgtcgcctatattggcaacctgctg
gaagacccgatgaaaatcttaatgtaa

DBGET integrated database retrieval system