KEGG   Acetobacterium woodii: Awo_c12770Help
Entry
Awo_c12770        CDS       T01732                                 

Gene name
glpK3
Definition
glycerol kinase GlpK3 (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
awo  Acetobacterium woodii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:awo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Awo_c12770 (glpK3)
Enzymes [BR:awo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Awo_c12770 (glpK3)
Exosome [BR:awo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Awo_c12770 (glpK3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1484407..1485897)
Genome map
AA seq 496 aa AA seqDB search
MKKYILSLDAGTTSSRAILFNHDSEIVSVAQKEFTQIYPKAGWVEHDAMEIWATQSGVVT
EAMSKIGATAEDIAAIGITNQRETTVVWDRKTGEPIYNAIVWQCRRTAAFCDELKARGLE
DYVRENTGLVIDAYFSGTKINWILNNVPGARERAEKGELAFGTIDTWLIWKLTDGKVHVT
DYSNASRTMAFNIKTLKWDEKMLKELDIPVSMLPEVRPSSAVYGSTTLYGTEIPIAGAAG
DQQAALFGQACFEPGMAKNTYGTGCFMLMNTGDKPVKSNSGLVTTIAWGLDGEVDYALEG
SIFVAGAAIQWLRDEVRLVDSSPDSEFYCNKVPDTNGVYMVPAFVGLGAPHWDMYARGAI
LGLTRGANKSHLIRATVESLAYQTKDVLDAMEKDSNIKLAALKVDGGACANDFLMQFQAD
ILGVPVDRPSIVETTAMGAAYLAGLAVKFWDGKADVTAAWKLDRTFQPAMDADVRAKLYA
GWLKAVECSKGWEDVE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtatatcttatcactggatgcaggaaccacgagttcaagagcgattttattt
aaccatgacagcgaaatcgtcagtgttgcacaaaaagaatttactcaaatttatcctaaa
gccggttgggttgagcatgacgccatggaaatttgggctacccaaagtggtgttgttacc
gaagctatgtcaaaaattggtgctacagctgaagatattgcggcaatcggtatcacaaac
caacgtgaaacaactgtcgtttgggacagaaaaacaggcgaacctatttataatgccatt
gtctggcaatgccgtcgtaccgctgctttctgtgacgaattaaaagcgcgcggattagaa
gattatgttcgtgaaaacaccggtcttgtaatcgatgcatatttttccggaacaaaaatt
aactggattcttaacaacgtccctggtgcccgtgaaagagctgaaaaaggggaacttgct
tttggaacaattgatacctggttgatctggaaattaactgatggtaaagtccatgtaact
gattattcaaatgcttctcgaacgatggcatttaatattaaaaccctaaaatgggacgaa
aaaatgttaaaagaactggatattcctgtttctatgttacctgaagttagaccttcttct
gctgtttatggaagtaccaccctttatggcactgaaattccgattgccggtgctgccggt
gatcagcaagcggcgctctttggacaagcttgtttcgaacctggaatggctaaaaatact
tatggaaccggttgctttatgctgatgaacacgggtgataaaccggttaaatcaaacagc
ggtttggttactacgattgcctggggtttagatggcgaagtggattacgcacttgaaggt
tcaatctttgtcgccggtgctgccattcaatggttaagagatgaagtccgacttgttgat
tcttcacctgatagtgaattctactgtaataaagtgcctgacaccaatggcgtatatatg
gttcccgcttttgttggcctgggtgctccgcattgggatatgtatgctcgcggcgcaatc
ttaggattaacccgtggtgccaacaaatctcatttaatccgagcaaccgttgaatctcta
gcttatcagactaaagatgttttggatgccatggaaaaagattccaacattaaattagcc
gctttaaaagtcgatggtggcgcttgcgctaacgacttcttaatgcaattccaggctgat
atcttaggtgttcctgttgatcgtccttcaattgttgaaacaactgcaatgggtgctgcc
tatcttgctggtttagctgttaaattctgggatggcaaagcggatgtaactgctgcctgg
aaacttgaccgtacattccaacctgctatggatgctgatgttcgggctaaattatatgct
ggttggttaaaagccgttgaatgctcaaaaggctgggaagacgtcgaataa

DBGET integrated database retrieval system