KEGG   Acetobacterium woodii: Awo_c12790Help
Entry
Awo_c12790        CDS       T01732                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
awo  Acetobacterium woodii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:awo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Awo_c12790 (pfkA)
   01230 Biosynthesis of amino acids
    Awo_c12790 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Awo_c12790 (pfkA)
   00030 Pentose phosphate pathway
    Awo_c12790 (pfkA)
   00051 Fructose and mannose metabolism
    Awo_c12790 (pfkA)
   00052 Galactose metabolism
    Awo_c12790 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Awo_c12790 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Awo_c12790 (pfkA)
Enzymes [BR:awo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Awo_c12790 (pfkA)
Protein phosphatases and associated proteins [BR:awo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Awo_c12790 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1489949..1490905
Genome map
AA seq 318 aa AA seqDB search
MRIGILTSGGDAPGMNAAIRAVVRTAIFNKIEVYGIHRGYAGLLEEDIVPLNVYSVADIL
QRGGTILRTSRSEFFATDAGVKKGAEVLEAYGIEHLVVIGGDGSFKGALALQKEGVSVIG
IPGTIDNDIGCSDYTIGFDTAVTTALDAISKIRDTTYSHNRINVIQVMGRKCGDIALYSG
LSGGAEALILPEVKTDLDGICQRLLVGKDRGKLHSIVMLAEGCGNYRDYCVEIEERTQVT
TKGTNLGYIQRGGSPSNIDRNLACFMGYNAVQAIIKKETGSVMVQRFGGYQGIPLEEAIQ
IPKVFRQDIYDIAMVLSI
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgggattttgactagcggtggggatgcaccgggaatgaacgcagcgatccgg
gctgttgtaagaaccgccatttttaacaaaattgaagtttatgggattcatcgcggttat
gcggggttattggaagaagatattgtaccattgaacgtttattccgtagccgatattctc
caacggggaggaaccattctgagaacatcccgaagcgaattttttgcgacggatgccggc
gttaaaaaaggtgctgaagtccttgaagcatatggaatcgaacatctggttgtaatcggt
ggtgatgggagttttaaaggggcattggcgcttcaaaaagaaggcgttagtgtgattggg
ataccgggaacgattgacaatgatattggttgcagtgactatactattggttttgatacc
gcagtaacaaccgcactggatgcaatcagcaaaattagagacacgacttactcccataat
cgtattaatgtgattcaggtgatggggcgaaaatgtggagatattgccctttattcaggg
ttatccggcggtgcggaagcgttgatcttaccagaagtaaaaacggatctggatgggatt
tgtcagcgccttttggtgggcaaagatcgtggaaaacttcacagtattgtgatgcttgcc
gaaggttgcggtaattatcgggattattgtgtagaaattgaagaacggactcaagttaca
accaaaggcacaaacttaggttatattcaaagaggcggttcgccttccaacattgatcgg
aatttagcttgttttatgggatataatgctgttcaggcaatcattaaaaaggaaaccgga
agtgttatggtacaacgttttggcggttaccaggggattcctctggaagaggccattcaa
ataccaaaggtattccgtcaggatatatatgatattgccatggtattgtccatttag

DBGET integrated database retrieval system