KEGG   Acetobacterium woodii: Awo_c16150Help
Entry
Awo_c16150        CDS       T01732                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit PyrB (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
awo  Acetobacterium woodii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:awo00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:awo00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1903947..1904873
Genome map
AA seq 308 aa AA seqDB search
MLKGRHLIEPGDFELDEIESIMQLADNIIADPEGYSLVCKGKLLASLFYEPSTRTRFSFE
AAMLRLGGEIIGFDDPNNSSVSKGESLGDTIRTIECYSDIAVIRHPREGTARLVSKFANE
MPIINAGDGGHEHPTQTLTDLLTIRKYKGSCDNHVVGVCGDLLFGRTIHSLVKTLNRYQG
VKFVFISPQELKMPAHILHQLDSQNYQETTSLDEVIGDLDILYMSRVQRERFVSEEEYLR
LKNYYILDRKKMKGAKEDMIVMHPLPRVNEIATEVDEDPRAVYFNQAKYGMYVRMALIAK
LLGVEDKK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaggaagacatttaatcgagcctggagactttgaattggatgaaattgaatcg
attatgcagctggctgataatattattgcagacccggagggttattctttggtttgtaag
ggaaaattattggccagccttttttatgagccctccacccggactcgattcagttttgaa
gcggcgatgcttcgtttaggcggcgaaatcattggatttgacgatcctaataattcatca
gtttcaaaaggcgaaagtttaggcgataccatccgcaccattgaatgttattcagatatt
gcagtgatcagacatccgcgcgaaggaaccgcccggctggtttctaaatttgctaacgaa
atgccgattattaatgccggagacggcggacacgaacatccaactcaaacgttaactgat
ttgttgacaattagaaaatataaagggagttgtgacaatcatgtggttggcgtttgcggc
gatttacttttcggccgaacgattcattcgttagtcaaaacgctgaatcgctaccaaggg
gtaaaatttgtgtttatctcacctcaggaacttaaaatgccggcacatattttgcatcaa
ctggattcccaaaattatcaggaaacaaccagcttggacgaggtcattggtgatttggat
atcctttatatgtctcgggttcaacgagaacggtttgtgagtgaagaagagtacttacga
ctgaaaaattattatatacttgatcgaaaaaagatgaagggtgccaaagaagacatgatt
gtaatgcatcccctcccgcgcgtgaatgaaatcgccactgaagtggatgaagacccaaga
gccgtttactttaatcaggcaaaatatggaatgtatgtcagaatggcactgattgccaaa
cttttgggagtggaggataaaaaatga

DBGET integrated database retrieval system