KEGG   Acetobacterium woodii: Awo_c20490Help
Entry
Awo_c20490        CDS       T01732                                 

Definition
putative kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
awo  Acetobacterium woodii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:awo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Awo_c20490
Enzymes [BR:awo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Awo_c20490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2423506..2423754
Genome map
AA seq 82 aa AA seqDB search
MMVLSYKINTVNTTAAGDAYIGTLAKAFVEMGDLVAAAKYASAAGAFICTPFGAQPSLPT
KLRSMPFWRCRNNFSDKFFLAG
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgatggtcctatcttataaaattaacactgttaataccactgctgccggcgatgcttac
attggcacattagccaaagcttttgttgaaatgggcgatctggttgccgctgcaaaatat
gcaagtgcagcaggtgcatttatttgtactccatttggcgcccagccgtcgctccccact
aagctgagatcgatgcctttctggcgatgcagaaataattttagtgataaatttttttta
gccggctaa

DBGET integrated database retrieval system