KEGG   Acetobacterium woodii: Awo_c21650Help
Entry
Awo_c21650        CDS       T01732                                 

Gene name
gmk
Definition
guanylate kinase Gmk (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
awo  Acetobacterium woodii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:awo00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2552504..2553169)
Genome map
AA seq 221 aa AA seqDB search
MSDCPVVNHELKESSELFFEREKGILIVISGPSCAGKGSVCKIICRKNPDLRLSISETTR
QPRNNEKHGREYFYISKECFEKRIEQGQYLEYATVYENYYGTPKDYVENLLESGFDVILE
IDIQGAAKVRTNYKEGIYIFIVPPSMQELKRRIEERGTESKEQMEMRLNCAYEEMKNADD
YSYIVINDELEDAAQRVQSIITAEKCRTERLKNKIEDILGR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattgtccagtagtaaaccacgaattaaaagagtcgtcagagctcttttttgag
cgcgaaaaaggtattcttattgttatatcgggaccgtcttgtgcgggcaagggtagtgtg
tgtaaaatcatttgtcgtaaaaatccggatcttcggttgtcaatttcagaaacaacacga
cagccaagaaacaatgagaaacacgggcgagagtatttttatatttctaaagaatgtttt
gaaaagcgaattgagcaaggacaatacctggaatatgctaccgtttacgaaaattattat
ggaacacctaaagattacgtggaaaatttattggaatcaggttttgatgtgatattagaa
atagatattcaaggagctgcaaaagttcggacgaactataaagagggtatttatattttt
atcgtgccaccttcgatgcaggagctcaaacgacgaatcgaagaacggggtactgaaagt
aaagaacaaatggaaatgcgcttgaattgcgcctatgaggaaatgaagaatgcggatgat
tacagttatattgtcattaatgacgaacttgaagatgccgcgcaacgcgtgcaaagtatc
atcaccgctgaaaaatgtcgaactgaaagattgaaaaataaaatcgaagatatacttggg
aggtaa

DBGET integrated database retrieval system