KEGG   Acetobacterium woodii: Awo_c22830Help
Entry
Awo_c22830        CDS       T01732                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
awo  Acetobacterium woodii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:awo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Awo_c22830 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Awo_c22830 (glcK)
   00052 Galactose metabolism
    Awo_c22830 (glcK)
   00500 Starch and sucrose metabolism
    Awo_c22830 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    Awo_c22830 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Awo_c22830 (glcK)
   00524 Butirosin and neomycin biosynthesis
    Awo_c22830 (glcK)
Enzymes [BR:awo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Awo_c22830 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2672944..2673864)
Genome map
AA seq 306 aa AA seqDB search
MGIGIDLGGTTVKGAVVNDQGEILNNRSFKTDGFRGYPEILNDMKELIKELLTLSPGEKR
VGIGIPGILSGDGNTIVSCPNLNWQNIPLKHDLESELALEVLLVNDATAASIAEAAFGST
QGHKNSVMITLGTGVGGGVILNNRIISGAHGVASEIGHLLMEKNFYTCSCGKNGCLETFA
SATAIIKYCQMQLERGRKSTLRTVVDFDGKAILNAAKAGDPLAEEAVHRLAKYLGWAIAN
ICGIIDPSIIAIGGGLSYAGEFLLEIIKIETIKRLTYPDIATPEIVLARFRNEAGMIGCA
NLQHYL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgggtattggtattgatttaggagggacgactgttaaaggtgcggttgtaaatgatcaa
ggcgaaatattgaataaccgatcatttaaaacagacggatttcgcggttatcctgagatt
ctgaatgacatgaaggaattgattaaagaattgcttacgctttcacctggtgaaaaacga
gtggggattggcatccccgggattctttcaggtgatggcaataccattgtttcctgccct
aatctcaattggcaaaatattccgctgaaacatgatttggaaagtgagttagcattagaa
gttttgctggtcaacgatgcgacagccgccagtatcgctgaagctgcttttgggagcaca
caaggacataaaaattcggtgatgattacgcttggtaccggtgttggtggtggtgtaatt
ttaaataatcgcattatttcaggagctcatggcgtggcttcagaaatcggtcatttactg
atggaaaaaaacttttatacctgtagctgcggtaaaaatggctgcctggaaacatttgct
tcagctacggcgattattaaatattgccaaatgcagctggagcgggggcgcaaatcaaca
ctccgtacggttgtcgattttgacggcaaagcaatcttaaatgcggccaaagcaggtgat
ccgttggcggaagaagcagtgcatcgattggctaaatatttggggtgggcgattgccaat
atctgtgggattatcgatccatcaataatagccattggcgggggattatcctatgctggg
gaatttttactggagataataaaaattgaaaccattaaacgcttgacttatcccgatatt
gcgacgcctgaaattgtacttgccagattcaggaatgaagcagggatgattggttgtgca
aatcttcagcactatttataa

DBGET integrated database retrieval system