KEGG   Acetobacterium woodii: Awo_c22830Help
Entry
Awo_c22830        CDS       T01732                                 

Gene name
glcK
Definition
(GenBank) glucokinase GlcK
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
awo  Acetobacterium woodii
Pathway
awo00010  Glycolysis / Gluconeogenesis
awo00052  Galactose metabolism
awo00500  Starch and sucrose metabolism
awo00520  Amino sugar and nucleotide sugar metabolism
awo00521  Streptomycin biosynthesis
awo01100  Metabolic pathways
awo01110  Biosynthesis of secondary metabolites
awo01120  Microbial metabolism in diverse environments
awo01130  Biosynthesis of antibiotics
awo01200  Carbon metabolism
Module
awo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
awo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:awo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Awo_c22830 (glcK)
   00052 Galactose metabolism
    Awo_c22830 (glcK)
   00500 Starch and sucrose metabolism
    Awo_c22830 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    Awo_c22830 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Awo_c22830 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Awo_c22830 (glcK)
Enzymes [BR:awo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Awo_c22830 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: AFA49056
UniProt: H6LCR9
Position
complement(2672944..2673864)
Genome map
AA seq 306 aa AA seqDB search
MGIGIDLGGTTVKGAVVNDQGEILNNRSFKTDGFRGYPEILNDMKELIKELLTLSPGEKR
VGIGIPGILSGDGNTIVSCPNLNWQNIPLKHDLESELALEVLLVNDATAASIAEAAFGST
QGHKNSVMITLGTGVGGGVILNNRIISGAHGVASEIGHLLMEKNFYTCSCGKNGCLETFA
SATAIIKYCQMQLERGRKSTLRTVVDFDGKAILNAAKAGDPLAEEAVHRLAKYLGWAIAN
ICGIIDPSIIAIGGGLSYAGEFLLEIIKIETIKRLTYPDIATPEIVLARFRNEAGMIGCA
NLQHYL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgggtattggtattgatttaggagggacgactgttaaaggtgcggttgtaaatgatcaa
ggcgaaatattgaataaccgatcatttaaaacagacggatttcgcggttatcctgagatt
ctgaatgacatgaaggaattgattaaagaattgcttacgctttcacctggtgaaaaacga
gtggggattggcatccccgggattctttcaggtgatggcaataccattgtttcctgccct
aatctcaattggcaaaatattccgctgaaacatgatttggaaagtgagttagcattagaa
gttttgctggtcaacgatgcgacagccgccagtatcgctgaagctgcttttgggagcaca
caaggacataaaaattcggtgatgattacgcttggtaccggtgttggtggtggtgtaatt
ttaaataatcgcattatttcaggagctcatggcgtggcttcagaaatcggtcatttactg
atggaaaaaaacttttatacctgtagctgcggtaaaaatggctgcctggaaacatttgct
tcagctacggcgattattaaatattgccaaatgcagctggagcgggggcgcaaatcaaca
ctccgtacggttgtcgattttgacggcaaagcaatcttaaatgcggccaaagcaggtgat
ccgttggcggaagaagcagtgcatcgattggctaaatatttggggtgggcgattgccaat
atctgtgggattatcgatccatcaataatagccattggcgggggattatcctatgctggg
gaatttttactggagataataaaaattgaaaccattaaacgcttgacttatcccgatatt
gcgacgcctgaaattgtacttgccagattcaggaatgaagcagggatgattggttgtgca
aatcttcagcactatttataa

DBGET integrated database retrieval system