KEGG   Acetobacterium woodii: Awo_c26960Help
Entry
Awo_c26960        CDS       T01732                                 

Definition
recombinase D (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
awo  Acetobacterium woodii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:awo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3153482..3155695)
Genome map
AA seq 737 aa AA seqDB search
MESIKGTVEHIVFRNSNNGYTVAHFDIDGDLVTVVGNFDELNHGEYLKLTGYWTEHKNYG
DQFCMETYAMEIPTSSEGIIRYLASGILPGIGEKTAKAIVARFGEETLDILDNNPERLSE
IKGIGKKTLAGIKEIYHEQREVRQIMIQIQDYGISANWAMKLYKTYKFDTISVLLNNPYQ
MIEDIRGIGFKIADQIANHLGFELNSPGRILAGINYALGECYNRGNTYMTETELIETSSR
ILGVDEDEINAQLGELVLLGRIIQEEIADQRVYYPRNLYEAEDNTALSMARISQLSYKIA
DVDIDTKIKNYERDMSITLDNKQREAIAAAMDNGVIVITGGPGTGKTTIINGIVRIFKDL
GLKTVLAAPTGRAAKRITETTGNEAKTIHRLLEYEYSQDDDFPSFSKDETNQLEVDAIIV
DESSMIDILLMDSLLMAVQPGTRLILVGDADQLPSVGPGNVLKDIIESGAIKVLSLERIY
RQSEESMISVNAYEINHGRMPDINNQSDFLFLNKNDGDKLLRDILELVTSRLPIAKGFDS
LHDIQVISPMKNGKVGVINLNRELQAVLNPPTETAAQREFGMVIYREGDKVMQIKNNYRI
KWEDTFSREEGEGIYNGDIGILESISNREKSFAILFNDGKRVLYDFDQMDEITHAYAMTV
HKSQGSEFPVVVMPIVGGPPLFLNRKLLYTAVTRAKKLLILMGNQYVFRQMIKSSAAQER
QTALKDRIIAYIKHPMA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtattaagggaacggtggaacacatcgtctttagaaatagcaataacggctac
accgtagctcattttgacatcgatggcgatctggttaccgtggttggcaatttcgacgaa
ttgaatcatggtgaataccttaaactgaccggttactggaccgaacacaaaaactatggc
gatcaattttgcatggaaacgtatgcgatggaaatacccacctccagcgaagggatcatc
cgctatttagcatcagggattttacccggaattggagagaaaacggccaaagcgattgtc
gcccgatttggtgaagaaaccctggatatcctggataacaacccggaacgcttgtcggaa
ataaaagggattggcaaaaaaactttggctggcataaaagaaatttatcacgaacaacgg
gaagtccggcagatcatgattcagattcaagactatgggatttcagccaactgggcgatg
aaactttacaaaacctataaatttgacacgatttcagtgctgctcaataatccttaccaa
atgattgaggatatcagagggattggctttaaaatagccgatcagattgcgaatcatctg
ggttttgaactcaatagccccggtcggattttggccggaatcaattatgctcttggcgaa
tgttacaatcgcggtaatacctatatgaccgaaaccgaactgattgaaaccagctcccgg
attttaggggtggatgaagacgaaattaacgcccaactgggggaactggtgttgctgggg
cgaatcattcaggaagaaatcgccgatcaacgggtgtattatccccggaatctttacgaa
gcagaggataatacggccctttcgatggcgagaatcagccagttaagttataaaattgcc
gatgttgacatcgatacaaaaataaaaaactacgaacgtgatatgtcaattacgttggat
aataaacaacgggaagcaattgcggccgcgatggataatggcgtgattgtgattaccggc
ggaccgggaaccgggaaaaccaccattattaatggaatcgtgcggatttttaaagatctg
gggttaaaaacggttttagccgcgccaactggacgggcggccaaacgaattaccgagacc
accggcaatgaggcaaaaaccattcatcgtttgctggaatacgaatacagtcaggatgac
gattttcccagtttcagcaaggacgaaaccaatcaacttgaggttgatgccattattgtt
gatgaatcgtcgatgattgatatcttattgatggatagtttgctgatggccgtgcaaccc
gggacacgacttattttggttggcgatgccgatcagttgccgtcggtggggccgggcaat
gttttaaaagacatcatcgaaagtggtgctattaaggtgttaagtctggagcgcatttat
cgccaatccgaggaaagcatgatttcggttaacgcctatgaaattaaccacggacggatg
ccggatattaataaccagagtgactttttgtttcttaataaaaacgacggggataaattg
ctccgggatattctcgagttggtgaccagccggttgccgatcgccaaaggatttgacagc
ttacatgacattcaggtgatttcgccgatgaaaaacggaaaagttggggtgatcaacctc
aatcgcgagttgcaagcggtgttaaacccgcccaccgagaccgccgcccaacgtgagttt
ggaatggtgatttatcgggagggcgataaggtgatgcagattaaaaataactatcggata
aaatgggaagatacttttagcagagaagaaggcgaggggatttataacggtgatatcggg
attctggaaagtatcagcaatcgggaaaaatcgtttgcgattttatttaatgacggcaaa
cgggtgctctacgactttgaccagatggatgaaataacccacgcgtatgcaatgacggtg
cataaaagccagggcagtgagtttcccgtggtggtaatgccgatcgttggcggcccgccg
ctgtttcttaatcgcaaactgttatatactgcggtgacgcgggctaaaaaactgctgatc
ctgatgggcaaccaatacgtctttcgtcagatgatcaaatcgtcagcggctcaggagcgc
caaaccgctctcaaagaccggattatcgcctatatcaaacacccgatggcgtaa

DBGET integrated database retrieval system