KEGG   Acetobacterium woodii: Awo_c28790Help
Entry
Awo_c28790        CDS       T01732                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase IspE
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
awo  Acetobacterium woodii
Pathway
awo00900  Terpenoid backbone biosynthesis
awo01100  Metabolic pathways
awo01110  Biosynthesis of secondary metabolites
awo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:awo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Awo_c28790 (ispE)
Enzymes [BR:awo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Awo_c28790 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AFA49628
UniProt: H6LGW4
Position
complement(3332203..3333081)
Genome map
AA seq 292 aa AA seqDB search
MATIVLKARAKVNLALDVTGIRADGYHEMKMINHSIDLEDQLIFEPCDDEVLLTSNGQSI
PLDERNLVMKVVRKIQSQFNITKGIKIHLEKKIPAQAGLAGGSSDAAATLKGLNQLWGLN
LSTAELIEIGVTIGADIPYCLIGGTALVEGIGEKITPLQDLDKMFVLVVKPDIDIATPWA
FKKLDELTITKHPDITALIELLNNADYEHLQDVIGNVFENVAFACYPEIATLKKALLSQG
ALAAVMTGSGSTVVGYYRNYELAKRSWERCSDKYKLCFLTQTCEKEGVDDVE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggccacaattgttttaaaagcgagagcaaaagttaatttggctcttgatgtaacggga
attcgagcagatgggtaccatgaaatgaaaatgatcaatcattcaattgacctggaagat
caattgatctttgaaccctgtgacgatgaggttctgttaacatccaatgggcaatcgatt
cctcttgatgagcgtaatctggtgatgaaagttgtgcgaaaaattcaaagtcagtttaat
attactaaggggatcaaaattcatcttgaaaaaaaaatcccggcccaggcaggtttggct
ggcggaagcagtgatgcggcggcgacgttgaagggtcttaatcagctttggggacttaat
ctttcaacggctgaattgatcgaaataggagttacaattggggccgatatcccctattgt
ctaattggaggaaccgctttggtggaaggcattggagaaaaaataacaccactgcaagat
ctggataaaatgtttgtcttagttgttaaaccggatattgatattgcgacaccgtgggcg
tttaaaaaattggacgagttaacaattaccaagcatcccgatataacggcattgatagag
ttgctaaataatgccgattatgaacacctgcaggatgttattggcaatgtttttgaaaac
gttgcttttgcctgttacccggaaatagcaacgctaaaaaaagcgctgttgagccaaggg
gcactggcagcggtgatgacaggtagtggttcgacggtggtcggatattatcggaattat
gagttggcaaagcgatcatgggaacgatgcagtgataaatataagttgtgttttttaact
caaacttgcgaaaaagaaggagtcgatgatgtggaatga

DBGET integrated database retrieval system