KEGG   Acetobacterium woodii: Awo_c30310Help
Entry
Awo_c30310        CDS       T01732                                 

Gene name
hemA
Definition
glutamyl-tRNA reductase (EC:1.2.1.70)
Orthology
K02492  
glutamyl-tRNA reductase [EC:1.2.1.70]
Organism
awo  Acetobacterium woodii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:awo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3487184..3488476)
Genome map
AA seq 430 aa AA seqDB search
MKLVVVGINHKDTPLEIREKGAFIHRTLNEGIQRLLKEDDIAEVIILSTCNRSEIYVSTR
NQDAAGEILVEFYLNEKSAELAPYLFLKKERDAMVHLYEVVTGLDSMILGEDQILGQVKD
ALEKSQAINGCGKYLTKMFREAITFTKKVKTEYKISETPLSLSSTAVKYIKRKYPDDYGD
KKILIIGSGKMGILALRYMKAEGFQNPFMTNRTFHNMHECQAIHENVQMIHYENRYQVIP
QMDVIITATASPHVILKAEEMKPLTKPLTIIDLALPRDVEEAVGDLPMVELLTIDHFKDI
MDEKMAYRMKVAKKIALEIQHEIDGLLAWITHAKVDNMVRDLNETSRHLAEETIENLCGH
LNLNEKEELYLSKVIRSKFREMVMPPIKQLKSLDNEAEIIGIEKTVTYLFPRINEKVIVG
EQKNDDTSAV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgttgtagtgggaattaaccataaagatacacccctggaaattagagagaaa
ggggcttttattcatcggacgttaaatgaaggcattcagcggttattaaaagaagatgat
atcgccgaagtgattattttgtcaacctgtaaccgcagtgagatttacgtatcgactcga
aatcaagatgcggccggggaaattttagttgagttttatctcaacgagaaatcagcggaa
ctggcaccgtatctttttcttaaaaaagaacgcgatgcgatggttcatctctatgaggta
gtgaccggacttgattcgatgattttaggggaagatcagatcttggggcaggtaaaagat
gccctggaaaaatcccaggccattaatggctgcggaaaatatctgacaaaaatgtttcgg
gaagcgattacctttaccaaaaaagttaaaaccgaatataaaatttcagaaaccccgttg
tcactcagctcaacggcggtgaaatatattaaacgtaaatatcccgacgattatggcgat
aaaaaaatcctcattattggctctgggaaaatgggcatcctggcgctacggtatatgaag
gccgaaggttttcaaaatccctttatgactaaccggacctttcataatatgcatgaatgt
caagcaattcacgagaacgtccaaatgattcattatgaaaatcggtatcaagtgattcct
caaatggatgtcattattaccgcgacggcctcgccgcatgttattttaaaagccgaggaa
atgaaaccattaacgaaaccgctgaccatcattgacttggcattaccaagagatgttgaa
gaagccgttggcgatttgcccatggtggaactgttaacgattgatcattttaaagatata
atggacgaaaaaatggcttatcgaatgaaggtggccaagaaaatagccctcgaaattcag
catgaaatcgatggactgctcgcctggattacccatgccaaggttgataacatggttcgg
gatttaaacgaaacctcccgacatttggcggaagaaaccatcgaaaacctctgcggtcat
ttaaatttgaatgaaaaagaagaactttatttaagcaaggtgatccgatctaaatttaga
gaaatggtgatgccgccgatcaaacaattaaaatcattggataatgaagcggaaatcatt
gggatcgaaaaaaccgtgacctacctgttcccgagaatcaatgaaaaagtgatcgtggga
gaacaaaaaaatgatgacacctctgctgtttaa

DBGET integrated database retrieval system