KEGG   Acetobacterium woodii: Awo_c31660Help
Entry
Awo_c31660        CDS       T01732                                 

Gene name
fpg
Definition
formamidopyrimidine-DNA glycosylase Fpg (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
awo  Acetobacterium woodii
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:awo03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3637462..3638274
Genome map
AA seq 270 aa AA seqDB search
MPELPEVETVRRTLKNFIIGKEITKITVHYDNIITGDTNAFVTSLTGQTIRDIDRVGKYL
IFILDTQAFISHLRMEGKYNIVAASKPLNKHEHLSFLFSDGSELRYQDTRKFGRLELVNK
ETYRHDLPLCKLGPEPWDADPQAIYRKIHKSNLPIKTLLLDQSLMAGIGNIYANEICFRM
KIHPATPGKRLSKKRVAELIDVSTEILTQAITQGGTTIHSFDANGITGLFQVQLQVHLQK
NCSVCNGAITKEMVRGRGTYYCPTCQKKQG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattaccagaagtcgaaactgttcgtcgaaccttaaaaaattttattattggc
aaagaaattacgaagatcactgttcattacgataacatcatcaccggggacaccaatgcc
tttgtcacgtcattaacaggacaaacaattcgcgatatcgatcgggtcggaaaatattta
atttttattttagacacccaagcgtttatttctcatttgcggatggaaggcaaatataat
attgtcgctgcttcaaaaccgcttaataaacacgaacatcttagttttttatttagtgat
ggcagcgaattacgttatcaggacacccgtaaatttggccgtttagaactggtgaataaa
gaaacctatcgtcacgatttaccactttgcaagcttggtcccgaaccatgggacgccgac
cctcaagccatctatcgcaaaatacacaaaagcaatctgccaattaaaacattgttgttg
gatcaaagccttatggccggtatcggcaacatttatgccaatgaaatctgttttagaatg
aaaatacatcctgccacccccgggaaacggcttagtaaaaagcgggtagctgaattaatc
gacgtctcgacagaaatactaacgcaggccatcacccaaggtggcaccaccattcactca
tttgatgccaatggtattaccgggttatttcaagtccagctacaagtccatctgcaaaaa
aactgttcggtttgtaacggcgccatcacaaaagagatggtgcgtggccgcggcacgtat
tattgcccgacgtgtcaaaaaaagcagggttag

DBGET integrated database retrieval system