KEGG   Amphibacillus xylanus: AXY_02800Help
Entry
AXY_02800         CDS       T02266                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
axl  Amphibacillus xylanus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
278418..279398
Genome map
AA seq 326 aa AA seqDB search
MKTLKEHFKDKFLVGAAVNAYTIDHDKELLTKHFNSITAENEMKPEHMQPEPNKFTFEVA
DKMIQFAEDNGMQLRGHTLVWHNQMPDWFFTDENGNDVSREELLKRMKDHITAVVSRYKG
RIHAWDVVNEAVEDRGEEMLRKSKWIDIIGEDFIDYAFKFAHEADPDALLFYNDYNESHP
EKREKIYQLVKGLLDRGVPIHGVGLQAHWNLYDPSYENIEAAIKRYSELGLQLHVTEMDV
SVFEFGDERTDVKEPTKEMLHLQAERYERFFDLFTKYQEHITSVTFWGISDAYTWLNDFP
VRGRKNWPFVLDEKGEPKPAYHRIVK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgttaaaagagcattttaaagataagtttttagtaggtgcagcagttaatgct
tacacaattgatcatgataaagagttattgacaaaacattttaactcaattacggcagaa
aacgaaatgaaaccagaacatatgcaaccagaaccgaataaatttactttcgaagttgca
gataaaatgattcaattcgctgaagacaacggtatgcaattacgcgggcatacacttgtt
tggcataaccaaatgccagattggttctttacagacgagaatggaaatgatgtatctcgt
gaagaactattaaaacgtatgaaggatcatattacagctgttgtttcacgctataaagga
cgtattcatgcttgggacgttgtgaatgaagcagtagaggatcgtggcgaagaaatgcta
cgtaaatctaagtggatcgatattattggtgaggacttcattgactacgctttcaaattt
gctcatgaagcagatccagatgcattattattctataatgactacaatgaatcacatcca
gagaagcgtgagaaaatctatcaacttgttaaaggtttactagatcgaggcgtgccaatt
cacggtgttggattacaggcgcactggaatctatatgatcctagctatgaaaatattgaa
gctgcgattaagcgttatagtgagttaggcttacagttacatgttactgaaatggatgta
tctgtatttgaatttggtgatgaacgtacagacgttaaagagccaacaaaagagatgctt
cacctacaagctgagcgttatgagcgtttctttgatttatttacaaaatatcaagagcat
atcacatcagttactttctggggtatttcagacgcatacacatggttaaatgacttccca
gttagaggtcgtaaaaactggccatttgtattagatgaaaaaggcgaaccaaagccagct
taccatagaattgttaaatag

DBGET integrated database retrieval system