KEGG   Amphibacillus xylanus: AXY_05280Help
Entry
AXY_05280         CDS       T02266                                 

Definition
(GenBank) putative ATPase
  KO
K02123  
V/A-type H+/Na+-transporting ATPase subunit I
Organism
axl  Amphibacillus xylanus
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
V/A-type ATPase, prokaryotes
Brite
KEGG Orthology (KO) [BR:axl00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    AXY_05280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
533513..535471
Genome map
AA seq 652 aa AA seqDB search
MIKDMKFVTIMGRQDDIDRMVDEYLSKYEIHFENALTELYGSKSLRPYTSPNPYAPYLER
VNQLWKYVSEEDQSKSQIIIDSPSMDILKVSIEQMEKHIEPYLKKDQELKVLKSEKQELL
DMISLFEGVNYPIEQILTMDHIHFQFGRFTHSNYEKFKKYVMDRFISIFIEGGKDEDYTY
GIYFTPKVSTERVDALYISMNWERIYVPDDEDYVGTPKEIIEKLTRKIAEIDHEIEQNNL
LIEEMIHPYASEIYSARSRLKVLSNNFSVRKYAALTHDEYLQTETQYLLMGWMPAEDAEQ
LIKETDEDPDVIAILEDDNDPPGGGVPPTKIKNAAIFRPFEMFTKMYGVPNYREFDPTWI
VALTYSLLFGIMFGDVGQGALLALGGYFIYKKKKADLGGIIALAGVCATFFGFMYGSIFG
FEEVIPALWLHPVSAMTDLPFIGSMNTIFVVAIGFGMFIILMTLILNIMSGIKTHETKAV
LFDRNGVAGLIFYASLIMVIVLFVTGNPIPGGIMLGILFGIPLIMMAFKEPLLSMMERKH
LEGSEGPVMFAVQAFFEIFEILLSYFSNTLSFVRVGAFAVSHAAMMQVVMMLSGAANGGD
INWLMVIFGNIIVIGLEGLVVGIQVLRLEFYEIFSHFYKGDGRPFENHLMKN
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
ttgattaaagatatgaaattcgtaaccattatgggaagacaagatgatatcgatcggatg
gtggacgaatatttatcgaagtatgaaatccattttgaaaatgcattaaccgagctttac
ggttcaaagagtttacgtccatacacgagtccgaatccatatgccccatacttggagcgt
gtgaatcagttgtggaagtatgtcagtgaagaagatcaatcaaaaagtcagattatcatt
gactcaccttcaatggatattttaaaagtatcaattgaacaaatggaaaagcatattgaa
ccttatttaaaaaaggatcaagagttaaaagtgttaaaatcagaaaaacaagaattactc
gatatgatttctttgtttgagggagtaaactacccaattgaacagattttgacgatggac
catattcattttcagtttggtcgttttactcactcgaactatgaaaagtttaagaaatat
gtgatggatcgatttatttctattttcattgaaggtgggaaagacgaggattatacgtac
ggtatttactttacacctaaagtgtcaactgagcgagttgatgcgttgtatatttcaatg
aactgggagcggatttatgttcctgatgacgaggattatgtcggtacaccgaaagaaatt
attgaaaagctaacaaggaagattgctgaaattgatcatgaaattgaacagaataattta
ttaattgaagaaatgattcatccttatgcatctgaaatctattcagcgagaagtagatta
aaagtattatctaataactttagcgttcgtaaatatgcggcactgactcatgatgagtac
ttgcaaaccgagactcagtatttattaatgggctggatgccggctgaggatgcagagcaa
ttaattaaggaaactgatgaagatccagatgtgattgcgatcttagaagatgataatgat
ccacctggaggcggtgtcccaccaacaaagataaaaaatgctgcgattttccgtccattt
gagatgtttacaaagatgtatggcgtgccaaattatcgtgaatttgatccaacttggatt
gtcgcattaacttattcattactatttgggattatgtttggtgacgttggtcaaggagca
ttactggcattgggtggttattttatttataaaaagaagaaggctgacttaggtggaatt
attgccttggcaggcgtatgtgcgacgttctttggttttatgtatggaagtattttcggt
tttgaagaagtcattcctgccctttggctacatccagttagtgcaatgactgatttacca
tttatcggatcgatgaatacgatctttgtcgtggcaattggatttggtatgtttatcatt
ttgatgacattaattttaaacattatgtctggaattaaaacacatgaaactaaggctgtg
ctattcgatcgaaatggagtagcaggtctaatcttttatgcatcactaattatggtaatt
gttttatttgttacaggtaatccaatacctggtggaatcatgctaggcatactatttggt
attccactgattatgatggcgtttaaagagccccttttatcaatgatggaaagaaagcac
ttagaaggcagtgaaggtcctgttatgtttgctgtacaagctttctttgagatatttgaa
attttattaagctacttttcaaatacattgtcatttgtaagggtaggtgcatttgcggtc
agtcacgctgcaatgatgcaagttgtcatgatgctatcaggtgcagcaaatggtggcgat
attaactggttaatggttattttcggtaacatcattgtcattggtttagaaggattggtt
gttggaattcaagtattacgtttagagttctatgaaatctttagtcacttttataaaggt
gatggaagaccgtttgaaaatcatttaatgaaaaattaa

DBGET integrated database retrieval system