KEGG   Amphibacillus xylanus: AXY_05370Help
Entry
AXY_05370         CDS       T02266                                 

Gene name
celA
Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
axl  Amphibacillus xylanus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:axl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
542891..544501
Genome map
AA seq 536 aa AA seqDB search
MSLVRQIKVNQLGYPVDADKIAVLTAKCSEFEVVNQKTKKIVYRGELSEPIEDQASNEVV
YHADFSNVSDSGHYYIQADGVRSATFLISDNPYFEARQGILKAFYFFRCGMELTEEYAGE
WAHKACHLAESIVFDNQECKLDGTGGWHDAGDYGKYTVPGAKAVADLLLAYELRPNAFNQ
AIPIPETDGVIPDILHECRYELDWLLKMQELETGAVYHKLTTLEFPGLDVMPEDDLDPQY
LTPVSATATGTFAATMAMAARIYKPFDQEFAAVCLERAEKAWQWLLMNPDVPGFKNPVEI
TTGEYGDEDDRDERFWAAAELYRTTGNENYHQALIELADEDFSKTEFGWADMGGYGTTAY
LLNGKALSNHDVYQKLMSELIHEAEKLLNNCSKDGYLISLENEDYVWGSNMGVMNKAMTL
LLAHHFTGNVAYKNCALDHVHYLFGRNALDISYVTGFGDRPVMEPHHRPSVGDQVDAPVP
GLVSGGPNAGLQDEYAAAHLQGKAPAKCFVDHEDSYATNEVTVYWNSPALFVLAHF
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcttgtacgtcaaattaaagtcaatcaattaggttatccagttgatgcagacaaa
atagctgtcttaactgcgaaatgttctgaatttgaagtcgttaatcaaaagacaaagaaa
atcgtttatcgaggagaattgtcggagcctattgaagatcaagcaagcaatgaagtggtt
tatcatgcggatttttctaacgtatcagatagtggccactactatattcaagcagatggt
gtaagatctgctacatttttgattagtgacaacccctattttgaggctcgtcaaggtatt
ttaaaggcattttattttttccgttgtggtatggaactaacagaggagtatgctggggag
tgggcccataaggcttgtcatctagcagaaagtattgtatttgataatcaagaatgtaag
ttggatggtacaggtggttggcatgacgcaggagattatggcaaatacacggtaccgggt
gccaaagcagtggctgatttattactagcttatgagcttagaccaaatgcatttaatcaa
gcgatcccaattcctgaaactgatggtgtgatacctgatattttacacgaatgtcgatat
gagctggactggctgttgaaaatgcaggagcttgaaactggcgccgtgtaccataaactg
actacactagaatttccaggacttgatgtcatgcctgaggatgatcttgatcctcagtac
ttaacacctgtttcggcaactgcaactggaacatttgcagcaacgatggcaatggcggca
agaatatataagccatttgatcaagaatttgcggctgtttgtttggaacgtgctgaaaaa
gcatggcaatggttgctcatgaatccagatgttcctggatttaaaaacccagtagaaata
acgactggtgaatatggtgatgaagatgatcgtgatgaacgattctgggcggctgcagag
ctataccgtacaactggtaatgaaaattatcatcaagcattgattgagctagcggatgag
gatttttcaaaaactgaattcggatgggctgacatgggcggatatggaaccactgcctac
ttgcttaatggtaaagcattaagtaatcatgatgtctaccaaaagcttatgtcagaatta
attcatgaagctgagaagttgcttaataattgttcaaaagatggctacttaatttctctt
gaaaatgaggattatgtttggggtagtaatatgggtgtgatgaataaggctatgacgcta
ttattggctcaccattttactggcaatgtggcatataaaaattgtgcactcgatcatgtt
cattatttatttggtcgaaatgcattagatattagctacgtgactggatttggtgatcga
ccagtaatggagccacatcatcgtccatctgtaggagaccaagttgatgcgcctgttccg
ggtttagtttctggagggccaaatgcgggattacaggatgaatatgcagcagcacatctt
caaggtaaggcaccagccaaatgctttgttgaccatgaagatagttatgcaacaaatgaa
gtgacggtttattggaattcaccagctctgtttgtattggcacatttttaa

DBGET integrated database retrieval system