KEGG   Amphibacillus xylanus: AXY_05920Help
Entry
AXY_05920         CDS       T02266                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
axl  Amphibacillus xylanus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:axl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AXY_05920
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXY_05920
  Lipid metabolism
   00071 Fatty acid degradation
    AXY_05920
  Amino acid metabolism
   00350 Tyrosine metabolism
    AXY_05920
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AXY_05920
   00626 Naphthalene degradation
    AXY_05920
Enzymes [BR:axl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AXY_05920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
608809..609768
Genome map
AA seq 319 aa AA seqDB search
MKGWLFTKTGVAPKLIEKEDPKPAKDEVVLDVKAAGLCHSDVGALEEESWMEIITAAPLI
FGHEAAGVVSELGEGVTDFEIGDRVGVAPINPVTKETIGYQRDGGYATKLVVPANQLIRI
PDGVSFVEGAAATDAGMTSHRALFGVGQAKKGDKVGIVGIGGLGQFALQMALATGCEVYA
ADIAEHARDFAEKSGAHGVAKDIAEFADKELDVIVDFAGFKESFKSCLKASAFHGTVVLA
GMGNTTLDLNVNDVILKELTIKGSNGGNADDIASVYEFFKKGSLKPQITTIPFEDIGKGL
EKLKNGEVSGRLVAEINPD
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttggttatttacaaaaacgggagtagctcctaaattaattgaaaaagaagat
ccaaaaccagcaaaagatgaagtggtattagatgtaaaagcagctggattatgtcactca
gatgttggagcacttgaagaagaatcatggatggaaattattactgcagctccattgatt
tttggtcacgaagcagcaggagttgtcagtgaattaggtgaaggagtaactgattttgaa
attggcgatcgtgttggtgttgctccaattaaccctgtaactaaagaaacaattggttat
caaagagatggtggttacgcaactaaattagttgtacctgctaaccaattgattagaatt
cctgatggcgtttctttcgtagaaggagcagctgcaacagatgctggtatgacttctcac
cgtgctttatttggagttggacaagctaaaaaaggtgataaagttggaattgtaggtatt
ggtggattaggacaattcgcattgcaaatggcattagcaacaggttgtgaagtttacgca
gctgatattgctgagcatgcacgtgattttgcagaaaaatctggtgcacacggcgtagcg
aaagatatcgcagaattcgctgataaagaattagacgtaattgttgacttcgccggattt
aaagagtcatttaagtcatgtcttaaagcaagtgcattccatggaactgttgttttagct
ggaatgggtaacactactcttgatttaaatgtaaacgatgtcatcctaaaagagttaaca
attaaaggaagtaacggtggtaatgctgatgatattgctagcgtttatgagttcttcaaa
aaaggaagcctaaaaccgcaaatcacaacaattccatttgaagatatcggaaaaggatta
gaaaaacttaaaaacggtgaagtttctggccgcctagttgccgaaattaaccctgattga

  All links  
No link information was found.   
DBGET integrated database retrieval system