KEGG   Amphibacillus xylanus: AXY_07760Help
Entry
AXY_07760         CDS       T02266                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
axl  Amphibacillus xylanus
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:axl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AXY_07760
Enzymes [BR:axl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AXY_07760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
812195..814225
Genome map
AA seq 676 aa AA seqDB search
MLSKKLNKIWYGGDYNPEQWDEETWQEDNRLFKLAGIDIASVNIFAWALIQPDEVTYDFS
NLDRTIDRLYQDGIYTCLATSTAAHPAWMAKRYPDIRRVDFEGRKRKFGGRHNSCPNSPT
YLKYACQLAGKLAEHYQDHPAVVAWHVSNEYGGYCYCDNCEKAFRVWLKDKYNSIDAVNT
AWNTAFWGHTFYEWDEIVAPNLLSEEWENGNNTNFQGISLDYRRFQSDSLLETYKLERDA
IKKHTPEIPITTNLMGLYPELDYFKWGKELDVVSWDNYPSIDTPVSKIAMTHELMRGLKS
GQPFMLMEQTPSQQNWQAYNALKRPGVMRLWSYQAIAHGADTVQFFQLRRSRGATEKFHG
AVIAHVGHEHTRVFNEVKQLGEELKQLGDQIIDSRTKAKVGLVFDYQNRWAINLSSGPSI
ALDYEAEVHKYYQAFYDLNIPVDMIGVEEDFNKYDLVIAPVLYMMKDGLADRLKAFVKNG
GTFVTTFLSGIADENDLVTLGGYPGELRELVGIWAEEIDALEPSIKNEIVFNQAHGHLQD
SYQCSTLFDLIHSEGAEVLATYGRDFYQGMPVLTKNKYGQGSAYYVASSPDQAFISDFVK
TLATENELTALLESDQGVEVASREKGDQQYLFVLNHNDHQAKFYPKDKVYQDLLSGQEFQ
GEATIAGHDVLILVEK
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgcttagtaaaaagctaaacaaaatatggtacggtggagattataatccggaacaatgg
gatgaggaaacttggcaagaagataatcgactatttaaactagctggcattgacatcgcc
tcggtcaatatttttgcttgggcattgattcagccagatgaagtgacctatgacttttca
aaccttgatcgaacgatcgatcgcttgtatcaagatggtatttatacttgtttagcaaca
agtacagcagcacatccagcttggatggcaaaaaggtaccctgatattcgtcgggttgat
tttgaggggagaaagcgtaaatttggtggtcgtcataattcctgtccgaacagtccaact
tatttgaaatatgcgtgtcagttagcagggaaactggcagaacactatcaagatcatcct
gcggtcgttgcttggcatgtgtcaaatgaatatggtggctattgttattgtgataactgt
gaaaaagcttttcgtgtttggttaaaggataaatataactcaattgatgcagtgaatacc
gcttggaacacagcgttttggggtcatactttttatgaatgggatgaaattgttgcccct
aatcttttgagtgaggaatgggaaaatgggaataatacaaattttcaagggatttcactt
gattatcgccgttttcaatcagatagtttattagagacgtataaacttgaaagagatgcg
atcaaaaagcatacacctgagattccaattacaacaaatttaatggggctctatccagaa
ttagattattttaaatgggggaaagagttggatgttgtttcatgggataactatccatcg
attgatacaccagtgagtaaaattgccatgacacacgaactgatgcgtggattgaaaagt
ggtcagccatttatgttaatggaacaaacaccatctcaacaaaattggcaagcctataat
gctttaaaacgccctggtgtgatgcgattatggagttatcaagcgattgcccacggggca
gatacggttcagtttttccaattgcgtcgttcacgtggagcaacggaaaagtttcacggt
gcagtgatcgcacatgtcggtcatgagcacacaagagtttttaatgaagtgaaacaatta
ggcgaggaactaaagcagcttggcgatcaaattattgatagtcgaacgaaggctaaagta
gggcttgtatttgattatcaaaatcgttgggcgattaatttatcaagtggaccttcaatc
gcacttgattatgaagcggaagttcataaatattatcaagctttttatgacctgaatatc
cctgttgatatgattggtgttgaagaagattttaataaatacgatcttgtgattgcacca
gtgctgtatatgatgaaagacggccttgctgatcgacttaaagcttttgttaaaaatggt
ggcacgtttgtgacaacattcttaagtgggattgctgatgaaaatgatcttgtgacgttg
ggtggttatccaggtgaactgagggagcttgttgggatttgggcagaagagattgatgca
ttagaaccttcaattaaaaatgagattgtcttcaatcaagcccatggtcatttgcaagac
agctatcagtgtagcacgttatttgatttaattcattcagagggagcagaagttttagca
acatatggtcgcgatttttaccaagggatgcctgtattaacgaaaaataaatatgggcaa
ggttcagcttattatgtggcatcaagccctgaccaagcctttattagtgattttgtcaaa
actttggcaaccgagaatgaactgactgcattgcttgagtcagatcaaggggttgaggtt
gcgagccgagaaaagggtgaccaacaatatctttttgtcttaaatcacaatgatcatcaa
gcaaagttttacccgaaagataaggtttatcaagacctactatctggtcaggaatttcaa
ggtgaggcaacaattgcaggacacgacgtacttattttagttgaaaaataa

DBGET integrated database retrieval system