KEGG   Amphibacillus xylanus: AXY_08410Help
Entry
AXY_08410         CDS       T02266                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
axl  Amphibacillus xylanus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:axl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AXY_08410 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AXY_08410 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AXY_08410 (thrC)
Enzymes [BR:axl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AXY_08410 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
883100..884161
Genome map
AA seq 353 aa AA seqDB search
MAWQGLLQEYKSFLPINDQTPMISLHEGNTPLIKLEKLSEKYGIEAYAKIEGVNPTGSFK
DRGMVMAIAKAIENGAKTVICASTGNTSASASAYAARAGIRSIIIIPEGKIAQGKLAQAV
MYGAETYSIEGNFDDALRIVRKLGERDDITLVNSVNPYRIEGQKTAAFEICDVLGKAPDY
LFIPVGNAGNITAYWKGFKEYHEAKQTGLPKMMGYEASGSAAIVHNRVIEHPETVGTAIR
IGNPASWKQAVAARDESGGIIDEITDDQMISAYQWLAENEGIFAEPASNSSIAGLLKALE
EGKVEKGAQVVCVLTGNGLKDPDTAIEYSTIKPTVLPNDDEIVINEIVGRESK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcatggcaaggtctattacaggaatataaaagctttttaccgatcaatgatcaaaca
ccgatgattagcttacatgagggcaatacgccactaattaaattagaaaaattatctgaa
aaatatggcattgaagcctatgcgaaaattgaaggcgtcaacccaaccggttcatttaaa
gatcgcggtatggtaatggcgatcgcaaaggcaatcgagaatggcgcaaagacagtaata
tgtgcatcaactggaaatacatctgcttcagcctcagcttacgctgcaagagcaggaatt
cgctcgattattattattccagaagggaaaattgctcaaggaaaactagctcaagcagtt
atgtatggtgctgagacttattcaatcgaagggaactttgatgatgcattaagaattgtg
cgtaaattgggtgaacgtgatgatattacattggtaaactcagtaaatccataccgaatt
gaaggtcaaaaaacagctgcttttgaaatttgcgacgttcttggtaaagcgccagattac
ttgtttattcctgttggtaatgcagggaatattacagcatattggaaaggcttcaaggag
tatcacgaagcaaaacaaacaggcttaccaaaaatgatgggctacgaagcaagtggctca
gcagcgattgtccataaccgagtaatcgaacatccagaaacggttggtacagctattcga
atcggtaatccagctagttggaagcaagcagtcgcggctcgagatgaatctggtgggatc
attgatgaaattactgatgatcaaatgatttcagcgtatcaatggttagctgaaaatgag
ggtatctttgcagagccagcttcaaattcttcgattgcaggattgcttaaggcattagaa
gaaggtaaggtcgaaaaaggtgcacaggtcgtctgtgtcctaactggaaatggacttaaa
gatccagatacagcaattgaatatagtacaattaaacctactgtcttgccaaatgatgat
gaaattgtgattaatgaaatagtaggtcgtgaatcaaaatga

DBGET integrated database retrieval system