KEGG   Amphibacillus xylanus: AXY_08550Help
Entry
AXY_08550         CDS       T02266                                 

Definition
(GenBank) putative aminopeptidase
Organism
axl  Amphibacillus xylanus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
894764..895819
Genome map
AA seq 351 aa AA seqDB search
MLENQDFLLELLNTPSPSSMEVEIQKKWINYVKDFADEIITDHAGNAIGVLNKDAQFKIL
LAGHIDEIALVVNRIDEDGFIYFDEVGRVNPKAAIGMRVRIQGYGKELIGVIGVNAQHLG
GIKGDFELSDLFIDVGAKSKAEVEQYVQIGDLIVYDRKPEILMDRYIAGRGLDNRTGAFI
VAEVLRKLANRDVKVGVYAASTVNEETNMGGAYFAASGIEPTMAIACDVTFATDHPNVDR
NKYGAVKLEGGPVIAKGAPINRKINQWLENTAEKLDMAIQYELTPRYTGTDADRMRLTGK
GVPVALVSLPLRYMHSPVETVSIKDIEQEIELLVEFIAGLTGEENLNPLED
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaaaccaagattttttattagaactacttaatacaccatctccatctagtatg
gaagtagaaattcaaaaaaagtggatcaactatgtgaaagattttgccgatgagattatt
acggatcatgcgggtaatgcaattggtgttttaaataaagatgctcaatttaaaatttta
cttgctggtcacattgatgaaattgcactagttgttaatcgcattgacgaggatggtttt
atttattttgatgaggttggtagggttaatccgaaagctgcaatcggaatgagagtacga
atccaaggttatgggaaagaattgattggtgtgattggcgttaacgctcaacacctcggt
ggaattaaaggtgactttgagctaagtgatctttttattgatgtcggtgcaaaatcaaaa
gctgaagttgaacaatatgttcaaattggcgatttaattgtttatgatcgtaaaccagag
attttaatggatcgctatattgcaggtcgtggcttggataatcgtacaggtgcatttatt
gtagcggaagttttacgaaaactagctaatcgtgatgtgaaagtcggtgtttatgctgca
agcacagttaatgaagagacgaatatgggtggtgcttattttgctgcatcgggcattgaa
ccgacaatggcaatcgcatgtgacgtgacatttgcaacagatcatccgaacgttgatcgc
aataaatatggtgcggttaagttagaaggtggtccggtgattgctaaaggtgcgccaatt
aaccgtaaaattaatcagtggttagaaaatacagctgaaaaattagatatggcaattcaa
tatgagttaactccgcgctatacaggaacagatgcagaccgaatgcgactaacaggtaaa
ggtgtccctgtcgctttagtgtcattaccattgcgatatatgcattcacctgttgaaaca
gttagtataaaagacatcgagcaagaaattgaattattagttgaatttattgctggctta
acaggagaagaaaatctaaatccattagaagattaa

DBGET integrated database retrieval system