KEGG   Amphibacillus xylanus: AXY_08550Help
Entry
AXY_08550         CDS       T02266                                 

Definition
aminopeptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
axl  Amphibacillus xylanus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:axl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AXY_08550
Enzymes [BR:axl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     AXY_08550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
894764..895819
Genome map
AA seq 351 aa AA seqDB search
MLENQDFLLELLNTPSPSSMEVEIQKKWINYVKDFADEIITDHAGNAIGVLNKDAQFKIL
LAGHIDEIALVVNRIDEDGFIYFDEVGRVNPKAAIGMRVRIQGYGKELIGVIGVNAQHLG
GIKGDFELSDLFIDVGAKSKAEVEQYVQIGDLIVYDRKPEILMDRYIAGRGLDNRTGAFI
VAEVLRKLANRDVKVGVYAASTVNEETNMGGAYFAASGIEPTMAIACDVTFATDHPNVDR
NKYGAVKLEGGPVIAKGAPINRKINQWLENTAEKLDMAIQYELTPRYTGTDADRMRLTGK
GVPVALVSLPLRYMHSPVETVSIKDIEQEIELLVEFIAGLTGEENLNPLED
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaaaccaagattttttattagaactacttaatacaccatctccatctagtatg
gaagtagaaattcaaaaaaagtggatcaactatgtgaaagattttgccgatgagattatt
acggatcatgcgggtaatgcaattggtgttttaaataaagatgctcaatttaaaatttta
cttgctggtcacattgatgaaattgcactagttgttaatcgcattgacgaggatggtttt
atttattttgatgaggttggtagggttaatccgaaagctgcaatcggaatgagagtacga
atccaaggttatgggaaagaattgattggtgtgattggcgttaacgctcaacacctcggt
ggaattaaaggtgactttgagctaagtgatctttttattgatgtcggtgcaaaatcaaaa
gctgaagttgaacaatatgttcaaattggcgatttaattgtttatgatcgtaaaccagag
attttaatggatcgctatattgcaggtcgtggcttggataatcgtacaggtgcatttatt
gtagcggaagttttacgaaaactagctaatcgtgatgtgaaagtcggtgtttatgctgca
agcacagttaatgaagagacgaatatgggtggtgcttattttgctgcatcgggcattgaa
ccgacaatggcaatcgcatgtgacgtgacatttgcaacagatcatccgaacgttgatcgc
aataaatatggtgcggttaagttagaaggtggtccggtgattgctaaaggtgcgccaatt
aaccgtaaaattaatcagtggttagaaaatacagctgaaaaattagatatggcaattcaa
tatgagttaactccgcgctatacaggaacagatgcagaccgaatgcgactaacaggtaaa
ggtgtccctgtcgctttagtgtcattaccattgcgatatatgcattcacctgttgaaaca
gttagtataaaagacatcgagcaagaaattgaattattagttgaatttattgctggctta
acaggagaagaaaatctaaatccattagaagattaa

DBGET integrated database retrieval system