KEGG   Amphibacillus xylanus: AXY_08560Help
Entry
AXY_08560         CDS       T02266                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
axl  Amphibacillus xylanus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:axl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
896209..898098
Genome map
AA seq 629 aa AA seqDB search
MSDFFVVLQLSSLISSEESQDDTSQSSQQMQNLGPISDPFFQNKYVKFAMPQSCGVNQEQ
TNQFYVSNDKSFAVIFTGQIDNAIELRKHLQESGYVFNSNSVSEMLLHLFVEYKARAFKK
LRGRFAIAVWSQEEKTVYAARDRLGLQPLYYHITNESLYISSSKKLLNDNTSNTQLNRQA
LQYYFNFQYVPEPFTLDKRVNRLEAGHYLFHKYDEQVQIHRYWQPSFSHLFLQQDQWVKR
IQDSLIESVSKQMKSDQRIGAFLSGGIDSSFIVSIAKQINPSIKTFSVGFEQEGFSEVDI
AKQTAAELGIENYAKIITAEEYIKNLPQIIAQMDDPLADPSCVPLYFVAQEARKHVEVAL
SGEGADELFGGYRIYREPLSLKVFDYIPTKMKEMLHRLAQMMPEGVKGKSYLERGTIPLK
DRYIGNAKMFENDELNSVLMHHDPNITYQQITEPLYQDVSTLHPVEQMQYVDLHTWLRGD
ILMKANQMLASHALELRTPFLADRVIDLAMGIPVNLKIAKGTTKYILREAAKGIVPEHVI
DRKKLGFPVPIRHWLKNEMYDWAKQVINESETDELINKAYFIKLLDLHRQGKNDYSRKIW
TAIIFMIWHRIFVKDDQIDHQLDEKRKIS
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatttttttgttgtgcttcaattgtcatcgttaatatctagtgaagagagtcaa
gatgacacttcacagtcttcacaacaaatgcaaaatcttggtccgattagtgatcctttt
tttcaaaataaatacgttaaatttgcaatgccacagtcgtgtggtgtcaatcaagaacaa
actaatcaattctatgtctcaaatgataaatcttttgccgttattttcacaggacaaata
gataatgcaattgaattacgcaaacatttacaagaaagcggctatgtctttaattcaaat
agcgtgtcagaaatgctgttacacctatttgttgaatataaagcgcgtgcatttaaaaaa
cttcgtggaaggtttgcaatcgcagtttggagtcaggaggaaaaaacagtttatgctgca
agagatcggttaggattgcaaccactttattatcatataactaatgagtcactttatatc
tcaagtagtaagaagttacttaatgacaatacgagtaatactcaattaaaccgccaagcg
cttcaatattattttaattttcaatacgtaccagaaccttttactttagataagcgagtg
aataggttagaggctggtcattatcttttccacaaatatgatgaacaggtacagattcat
cgttattggcaaccgtcattttctcatctttttctacaacaagatcagtgggtcaaacgt
atccaagacagcttgattgaatcagttagcaaacagatgaaatcagatcaaagaatcggt
gcatttttatctggagggatcgactcatccttcatagtatcaatcgcaaaacaaattaac
ccgtctattaaaactttttctgttggctttgaacaggaaggtttttcggaagttgatatt
gccaaacaaacagcggccgaacttggaattgaaaattacgctaagatcattactgctgaa
gaatatataaaaaatttaccgcaaattattgcgcagatggacgatccactagctgatcca
tcatgtgtacctttatattttgtcgcccaagaagcacgaaagcatgtcgaagtagcttta
tcgggtgaaggtgctgatgaattatttggtggttatcgaatttatcgagagccactttcg
ttaaaggtatttgattacataccgactaagatgaaagaaatgttgcatcgacttgctcaa
atgatgccagaaggcgtaaagggtaaaagttatttagaacgcgggacgatcccgttaaaa
gatcgctatattggtaatgcaaaaatgtttgaaaatgatgaactcaatagtgtacttatg
caccatgatcctaatattacttatcaacagattacggaaccattgtatcaagatgtgtct
acgttacacccggttgaacagatgcaatatgttgatttacacacttggttgcgtggcgat
attttaatgaaggctaatcaaatgttggcatctcacgctctagaattacggacgccattt
ttggccgatcgtgttattgatctggcaatggggattcctgttaacttaaaaattgctaaa
ggtacaacgaagtatattcttcgtgaggctgcaaaaggaattgttcctgaacatgtcatt
gatcgtaaaaagcttggctttcctgttccgattcgccattggttgaaaaatgagatgtat
gactgggctaaacaagtgattaatgaaagtgagacggatgaattaattaataaagcgtat
tttatcaaattacttgatttgcatcgccaagggaaaaacgattacagtagaaagatttgg
acggcaatcatatttatgatttggcatcgaatttttgttaaagatgatcaaattgatcat
caattagacgaaaaaagaaagattagttaa

DBGET integrated database retrieval system