KEGG   Amphibacillus xylanus: AXY_09300Help
Entry
AXY_09300         CDS       T02266                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
axl  Amphibacillus xylanus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:axl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:axl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:axl00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:axl00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:axl00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:axl00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:axl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
981210..982169
Genome map
AA seq 319 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAIRAVVRKGIYHGIEIYGVSNGFQGLMEGKIKKMELGSVGDI
IQRGGTILFSARSEEFKTDEGQERAIKQLRDRGIEGLVVLGGDGSFTGALKLTEKGFPCV
CIPCTIDNDIPGTDFTIGFDTALNTIVEAADKIRDTATSHERTYVIEVMGRDAGDLALWS
GLANGAESVIIPERDEPFENIIDRLNRGRARGKKHSIIILAEGVGSGIELGKRIEETANL
ETRVTVLGHIQRGGQPTGADRVLASRLGAKAIDLLIEGQSGVMVGIESNKLTHHKIKDIL
NKPHNIDMSLYKLMGELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatagctgttttgacaagcggtggagatgctccaggtatgaacgcagctatt
cgagcggtagtcagaaaaggtatctatcatggtattgaaatatacggtgtatcaaacggt
tttcaaggcttgatggaaggtaagatcaaaaaaatggaactcggctctgttggagatatc
attcaacgcggaggtacgattctgttttctgcgcgctctgaggaatttaaaaccgatgaa
ggtcaagaacgtgccattaaacaattgagagatagaggtattgaaggtttagtagttctt
ggcggtgacggttcatttacaggtgcgttaaaattgactgagaaaggctttccatgtgtc
tgcattccttgtacaattgataatgatattccaggaactgattttacaatcggttttgat
acagcattaaacactattgtagaagctgccgataaaataagagatacagcaacttctcat
gaacgtacatatgttatcgaggttatgggccgagatgcgggagatttagcactttggtca
ggtttagctaatggtgcagaaagcgtaatcattccagaacgcgacgaaccttttgaaaac
atcattgatcgtctaaatagaggacgagcacgtgggaaaaagcatagtattatcatttta
gctgaaggtgtcggtagtgggattgaactaggcaagagaattgaagaaacagctaatcta
gaaacacgcgtaaccgtattaggacacatccaacgtggtggacaaccaactggtgcagat
cgtgtattagcaagtcgtttaggcgctaaggcaatcgatttgttaattgaaggtcaatca
ggtgtgatggttggtattgagtcaaataaacttactcatcataaaatcaaggatatcctt
aataagccacacaacatagatatgagcttgtacaaacttatgggagaactatctatctaa

DBGET integrated database retrieval system