KEGG   Amphibacillus xylanus: AXY_09400Help
Entry
AXY_09400         CDS       T02266                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase/AP lyase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
axl  Amphibacillus xylanus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:axl03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
993750..994580
Genome map
AA seq 276 aa AA seqDB search
MPELPEVETVRQTLLKLVKDEVITSVDVFWPKIIKKPDDVSIFKQLLIGQSIKDINRKGK
FLIFELDHYSLVSHLRMEGKYGIYPKEAIKDKHTHVIFNFESGRSLHYHDVRKFGTMHLF
NKGEAHLELPLAKVGPDPFEPGYLFEDIYPKIKKSSRAIKNILLDQTIISGLGNIYVDET
LFRAKIHPLRQGTSLSETEVQFILKEAKDTLREAVKQGGTTIRSYTNSLGEIGLFQQELY
VYGQTGEPCKTCGSEIEKFKVSNRGTHICPSCQLIS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattaccagaggtcgaaacagttagacaaacattattaaaactagttaaagat
gaagtgattacatcagttgatgtgttttggccaaagattattaaaaaaccagatgatgta
tcaatctttaaacagttactaatcggtcaatcaatcaaggatattaaccgaaaagggaaa
tttctaatttttgaactagatcactattcattagtatctcatctacgtatggaaggaaag
tatggtatttatcctaaagaagcaattaaggacaagcatacacatgtgatctttaatttt
gagagtggaagatcactacattatcatgacgttagaaagtttgggacgatgcaccttttt
aacaagggcgaggctcaccttgaactgccacttgcgaaggttggtccagatccttttgaa
cccgggtatttatttgaagatatttatccaaaaatcaaaaaaagctcacgagcgattaaa
aatattttactcgatcaaacaattatttcagggttgggcaatatttatgttgatgagaca
ttatttagagcaaaaatccatccactacgtcaaggtacatcattatctgaaacagaagtt
caattcattttaaaagaagcaaaagatacactaagagaggctgtcaagcaaggtggaaca
acgatcagaagttatacaaatagtttaggtgagatcgggttattccaacaagagttatac
gtctacggtcagacaggtgagccatgtaagacttgtggttcagaaatcgagaaatttaaa
gtctcaaaccgtggtacccatatttgtcctagctgtcaactcatttcttag

DBGET integrated database retrieval system