KEGG   Amphibacillus xylanus: AXY_10650Help
Entry
AXY_10650         CDS       T02266                                 

Definition
DNA helicase RecD/TraA family protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
axl  Amphibacillus xylanus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:axl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1115655..1117988
Genome map
AA seq 777 aa AA seqDB search
MEEQLVIQTENFIKGELVYTIYSNPAEHFSIAKIKILETNEVYQEPEIVVKGYFSELQPG
EAYLFYGKIVEHKRFGLQYDVSHFKRYLPDTKEGLVAYLSSDLFYGIGEKTALKIVDQLG
ETAIQTIMDNPAVLDQIPGLTEERKKTLVEQLSEHQGFDHVVVHLSKYGIGLKMAQKIYE
VYKDQAIDLLMSNPYQYVFDIKGFGFHRADTIARQNKLELNHPSRIRAGCLYILYESMQD
GHVFLPVDQLCQEADRLLNATQNQITNEEINQQLVEMAEEESIVLDDEKAYLPYLYYAEA
GFSTHIKRILKQEPIEAVPEAELLKIVGEIEEEETLSYGKEQYEAIQQALHEKVMILTGG
PGTGKTTVIKGILRAFSSIHDVSLDLADYESKSKFPFILTAPTGRAAKRLSESTGLQAMT
IHRLLGWDGGDGFEKNEANQLEGRLIVVDEFSMVDIFLANQLFKAIPTNMHVLLVGDQDQ
LPSVGPGHVLADLLASNQIKAVELKEVYRQKEGSKIIELAHQIKHDRVESNTLTRAKDFN
FIRCQSYDIIDALKQIVQKALERDVDIKDMQILAPMYRTDIGIHRINQEIQQIVNPKRSS
VREIKTKDAIFRTGDKVIQLVNQPEDGVFNGDIGQITAIFKANENVEKEEQVVVTYDDID
VVYNRNDLKNITHAYCISIHKSQGSEFPIIIMPVDRSYRRMLRKNLLYTAITRAKKSLII
CGNEAAFLAGVREVDTNIRNTTLKERLTKVLTDEDYAEKLASATEEDHHLSPYDFLT
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacaattagtaattcaaactgaaaattttattaaaggagaattggtttatacg
atttactcaaatcctgcagaacacttttccattgcaaaaattaaaatccttgagacaaat
gaagtgtatcaagagcctgaaattgtagtaaaaggctattttagcgaactgcaaccaggt
gaagcctatttgttttacgggaaaattgttgaacataaacgattcggcttacaatacgat
gtaagccactttaaaagatacttaccagacacaaaagagggacttgttgcttatttatca
agtgatctattttatggaattggtgaaaaaacagcactaaaaattgttgatcaattggga
gaaacagcgattcaaaccattatggataatccagcagtacttgatcaaatacctggatta
acagaagaacggaaaaaaacgttagtcgaacagttgagtgaacaccaaggctttgatcat
gtcgttgtacacttgtcgaaatatggcattggtcttaaaatggcacaaaaaatttatgag
gtctataaagatcaagcgattgatttacttatgtctaatccttatcaatatgtgtttgat
attaaaggatttggttttcatcgagctgatacaatcgcaagacaaaataaactcgaatta
aaccacccatcaagaattcgcgctggctgtttatacatactttatgaatcaatgcaagat
gggcatgtgttcttaccggtagaccagctatgccaagaagctgatcgtcttttaaatgct
actcaaaatcaaattacaaatgaggaaattaatcaacagctagtagagatggcggaagaa
gaaagcattgttcttgacgatgaaaaagcatatttaccttatctgtattatgctgaggca
ggcttttcaacacatattaagcgaattttgaaacaagagccaattgaagctgttccagag
gcagagttattaaaaatagtcggtgaaattgaagaagaagaaacgcttagctatggtaaa
gaacaatacgaagcgattcaacaggctttacatgaaaaggtcatgattctgacaggtgga
cctggaacagggaaaacaacagtcataaaaggaatccttcgagcttttagcagtattcat
gatgtttcacttgatttagctgactatgagagtaaatcaaaatttccatttattttaaca
gcaccaacagggcgggctgcgaaaagattgtctgagtcaacaggcttacaagcaatgaca
attcacagactattaggctgggatggtggcgatggctttgaaaaaaatgaagccaatcag
ttggaaggccgtttaatcgttgttgatgaattttccatggttgatatttttcttgcgaat
caactcttcaaagcgattcctacgaatatgcacgtattattagttggggatcaagatcaa
ttgccttctgttggacctggacatgttcttgcagatttattagcatcgaatcaaattaag
gcagtagagcttaaagaagtatatcgacaaaaggaaggttctaaaattattgagcttgcc
caccaaataaagcacgatagagttgaatcaaatactctaacaagagcaaaagactttaac
tttatacggtgccagtcttatgacattatcgacgcattgaagcaaattgtccaaaaagca
ttagaacgtgatgtagatattaaggacatgcaaatactagcacctatgtatcgtacagac
attggtatacatcggattaatcaagaaattcagcagattgttaatcctaaacgatctagt
gtaagagagataaaaacgaaagatgctatttttagaacaggtgataaagttattcagctt
gtaaatcaacctgaagatggtgtttttaatggagatattggacaaattacagcaatattt
aaagcaaatgaaaatgttgaaaaagaagaacaagtcgttgtcacttatgatgatattgac
gttgtatataaccgaaatgatttgaaaaatattacacatgcttactgtatttcaattcat
aaatcacaaggtagtgaatttccgataattattatgccggttgatcgtagctatcgtcgg
atgctaaggaagaatttattgtatacagcgataacccgtgcgaaaaagtcgttgattatt
tgtggtaatgaagcagcctttttagctggtgttcgtgaagtggatacgaatattcgtaac
acgactttaaaagaacggttaactaaagtattaacggatgaagattatgctgaaaagctt
gcttcagcaacagaggaagaccatcatttatcaccatatgattttttaacttaa

DBGET integrated database retrieval system