KEGG   Amphibacillus xylanus: AXY_11420Help
Entry
AXY_11420         CDS       T02266                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
axl  Amphibacillus xylanus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:axl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AXY_11420 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXY_11420 (glcK)
   00052 Galactose metabolism
    AXY_11420 (glcK)
   00500 Starch and sucrose metabolism
    AXY_11420 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    AXY_11420 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AXY_11420 (glcK)
   00524 Butirosin and neomycin biosynthesis
    AXY_11420 (glcK)
Enzymes [BR:axl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AXY_11420 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1194365..1195324
Genome map
AA seq 319 aa AA seqDB search
MRNILLGVDIGGTTIKMGITNVDGQMIDKWEIPTQINDKADQIPNDIWNSIKEKLSVHQI
TEDQLIGIGAGAPGFVIADTGVIAEAVNLGWKNFPLGERLNQLSGLPVYVENDANIAALG
ENWLGAGDLSDDLIMITLGTGVGGGIITNGKIISGTNGTAGEIGHMTMVHDGHLCNCGRT
GCLETIASATGISRLAEEKVNRYQDSILYSTYQKKNKLSAKDVFKAYEKNDPCAKEVVSY
VLDVLGLAISNMTTVLNPEKILIGGGVSKAGDVLLNPLKASYQKYALPRIHQGSTIEIAR
LGNDAGIIGGAYLVKQHSL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaatattttacttggtgttgatattggtggcacaactataaaaatggggattact
aatgtagacggacagatgattgataaatgggaaattcccacacaaataaatgataaagct
gatcaaattccaaatgatatttggaattcaattaaagagaaattatcagtacatcaaata
acagaggatcaactaataggtattggagcaggagcacctggctttgttattgctgacaca
ggagtcattgcggaagctgttaacttagggtggaagaatttcccgctaggagagagatta
aatcaattatcaggtttaccagtttatgttgagaatgatgcaaatatcgcagcattaggt
gaaaactggttaggagctggtgatttatcagatgatttaatcatgattactctaggaaca
ggtgttggtggtggtattatcactaatggtaagattatcagtggaacaaatggaactgct
ggtgaaatcggccacatgacgatggtacatgatggtcatttgtgtaattgtggtagaaca
ggttgtctagaaacaattgcatctgcaacgggtatcagtagattagctgaagaaaaagtg
aatcgatatcaagattcaatcctttattcaacatatcaaaagaaaaataagttatctgca
aaagatgtatttaaagcatatgagaaaaatgatccatgtgctaaagaggtagttagctac
gtgcttgatgttttaggtctagcaatttctaatatgacaacagttttaaatcctgaaaaa
atattaattggtggtggtgtttctaaagctggagatgtacttctaaatccacttaaagca
tcatatcaaaaatatgcattaccgagaattcatcagggaagtacaatagaaattgcccgt
ttaggtaatgacgctggtattattggcggtgcttatttagtcaagcagcattcactatag

DBGET integrated database retrieval system