KEGG   Amphibacillus xylanus: AXY_14140Help
Entry
AXY_14140         CDS       T02266                                 

Gene name
melA
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
axl  Amphibacillus xylanus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:axl00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:axl00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:axl00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1451790..1453097
Genome map
AA seq 435 aa AA seqDB search
MTLMSKITFLGAGSTVFAKNVLGDCMTVEAIQDFEFALYDIDHERLNESEMMLNHLKKNL
NSNVTIKSYTDRKEALRGAKYVINAIQVGGYDPCTITDFEIPKKYGLRQTIADTLGIGGI
FRNLRTIPVMREFAKDMREVCPDAWFLNYTNPMAVLTSVMLQEGIKTVGLCHSVQVCADH
LLDSLGMSKDNVQWHIAGINHMAWLLEITRNGEDLYPEIKRRAKEKQKQKHLDMVRFELM
DKFGYYVTESSEHNAEYHPYFIKKNYPELIDKLNIPLDEYPRRCVAQIEGWKEMRDSIVN
NKDLTHTRTNEYGSYIIEAMETDQPIKIGGNVLNTGGIISNLPEKAVVEVPCLVDASGVQ
PTYVGELPEQLAALNRTNINTQLLTIEAAYTEKKEKIYQAALLDPHTAAELSMDDIISLC
DDLIEAHGDWLPKFS
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgactttgatgagtaaaattactttcctaggagctggtagtacagtttttgccaaaaat
gtacttggagactgtatgacagttgaagcgattcaagatttcgaatttgctctttatgat
attgatcatgaacgtttaaatgaatcagaaatgatgttaaatcatctaaagaaaaattta
aattcaaatgtaacgataaaaagctacacagatcgtaaagaagcactacgtggtgctaag
tatgttattaatgctattcaagttggtgggtatgacccatgtaccattacagattttgag
attcctaaaaagtatgggttacgccaaacgattgctgatacattgggaatcggggggatt
ttccgaaatttacgaacaattcctgtaatgcgtgaatttgctaaagatatgcgtgaggtt
tgtccagatgcttggttcttaaattatacgaatcctatggctgttttaacgtcagttatg
ctccaagaagggattaagactgttggactttgtcatagtgtacaagtatgtgctgatcat
ttattagattctctcggcatgtcaaaagataatgtacaatggcatatcgctggaattaat
catatggcttggttgcttgaaattacacgtaatggtgaagatttgtatcctgaaattaag
cgcagagctaaagaaaagcaaaaacaaaagcaccttgatatggtacgttttgagctgatg
gacaagtttggctattatgtgactgaatcatctgagcataatgcagaatatcacccttac
tttattaagaaaaattaccctgaattaattgacaagttaaacattccacttgatgaatat
ccaagacgctgtgttgctcaaattgaaggttggaaagaaatgcgcgattccattgttaat
aataaagaccttacgcacactcggacgaatgaatacggatcatatatcatcgaagctatg
gagacagatcagccgataaaaattggtggaaacgtattaaatacaggtggcataatctca
aacctacctgaaaaagcagttgtcgaagtaccttgtctagtcgatgcaagtggtgttcaa
cctacatatgttggtgaattaccagaacaattagctgcactaaatcggacgaatattaat
actcaattattaacaattgaagctgcatatactgaaaagaaagaaaagatttatcaagca
gcattattagatccgcatacggcagcagaattatctatggacgacatcatctcgctatgt
gatgacttaattgaagcacacggagattggttgccgaaattttcataa

DBGET integrated database retrieval system